KEGG   Prochlorococcus marinus AS9601: A9601_08971Help
Entry
A9601_08971       CDS       T00464                                 

Definition
glycoside hydrolase family protein (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9601_08971
Enzymes [BR:pmb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     A9601_08971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
771397..773157
Genome map
AA seq 586 aa AA seqDB search
MKQIDSEKKLDRLIIDKLLKTIYSNLTTEEINFISNQLLQILDDFSEKSSYEEIRYKERW
NESHSVLITYADSIYKDGEATLITLRKLLSKHFGSLSKVVHILPFLKSTSDGGFAVSSYD
SLEEKFGGWDDLKSISKNHDLMADLVLNHVSSSHPWVQQFIKSQEPGISNVFSPKQSLDW
SNVVRPRSSSLFSQINTDDGPKQVWTTFGPDQIDLNWHNPKMTLEFLNLITTYLSNGIKW
FRLDAVGFIWKESGTTCLHLPKAHSIVKLLRVLLNNLLDDGVLITETNVPQKENLSYLVP
DDEAHMAYNFPLPPILLEAIITSRADILNSWIFDWPELPEDTTLFNFTASHDGVGLRALE
GLMNEQRIKDLLINCEKRGGLVSHRRLSNGDDKPYELNISWWSAMEDSSRDSKRFQYERF
ILSQLLVMALKGVPAFYLPALLASENDIKSFSMTGQRRDLNREKFKSENLSAVLNNPESN
ANKNLKCLRNAMDVRSKLKQFHPCSQMKCLSKGRSDIVVIKRGIGPESVFAIHNMTENKI
NYQLNDNDLPKIIDNDFNIHDFLTSTKYNCKNISLDPFQVIWLSAL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaaattgattcagagaaaaaattagatagattaataattgataaattgttaaaa
acaatttattcaaatcttactacagaagaaattaattttatttcaaaccaattattacag
attttagatgatttctcagagaaatcttcttatgaagaaataagatataaggaaaggtgg
aatgaatctcattcggttttgataacttatgcagatagtatttataaagatggcgaggca
acattaataactcttagaaagttgttgagtaaacattttggcagtctttctaaagttgta
catattcttccttttttgaaatctacaagtgatggaggtttcgcggtttcaagttatgat
tccttagaagaaaaatttggtggttgggatgatctcaaaagtatatctaaaaatcatgat
ttgatggctgatttagtactaaaccatgtctcatcatctcacccatgggttcaacaattt
attaaatcccaggaaccagggatatcaaatgttttttcaccgaaacaaagtcttgactgg
tcaaatgtagttagacctagaagttcctctttgttttctcaaataaatactgatgatggt
cctaaacaagtttggacaacttttgggccagatcaaattgacttgaattggcataatcct
aaaatgactcttgagttcttaaatttaattactacttatttatctaatggaattaaatgg
ttcaggcttgacgctgtaggttttatttggaaggaatcagggactacctgcttacattta
cctaaagcgcattcaattgtgaaactattaagagttcttttaaataatcttcttgatgat
ggcgttttaataacagaaaccaatgttcctcagaaagagaatctatcttatctagttcct
gatgatgaagctcatatggcatacaatttcccattacctccaattctcctagaagcaatt
attacttccagagctgatattctaaactcatggatttttgattggccggaattacctgaa
gatactactctttttaactttactgcatcgcacgatggtgttgggctaagagctcttgag
ggtttaatgaatgagcagagaatcaaggatttattaattaattgtgagaaaagaggagga
ttagtaagtcatagacgtttatcaaatggtgatgataaaccttatgaattgaatattagt
tggtggagtgcaatggaagactccagtagagattctaaaagatttcaatatgagagattt
attttgagtcaactattagtaatggctctgaaaggagtccctgcattttatttgccagca
ttactagcttcagaaaacgatatcaaaagtttttctatgacaggtcaaagaagagatcta
aacagagaaaagtttaaatcagaaaatctttcagctgttttaaataatcctgaatctaat
gctaataaaaacttaaaatgtcttcgtaatgctatggatgtccgatcaaaattaaagcaa
tttcacccttgttcacaaatgaaatgtttgtctaaaggtagaagtgatattgttgtaatc
aaaagaggtataggtcctgagtctgtttttgcaatccataatatgactgaaaataaaatt
aattatcaattgaatgataatgatctacccaaaataattgataatgatttcaacatccat
gattttttgacatccactaaatacaattgcaaaaatattagtcttgatccttttcaagta
atttggcttagtgctttataa

DBGET integrated database retrieval system