KEGG   Prochlorococcus marinus AS9601: A9601_09181Help
Entry
A9601_09181       CDS       T00464                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A9601_09181 (ruvA)
Enzymes [BR:pmb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A9601_09181 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(790225..790902)
Genome map
AA seq 225 aa AA seqDB search
MISWINGDLVDLWQTNQKSFVLINCQGLGYEIQILESFFLKLKTNQISTKNITLWIKHIK
KEDSDLLFGFTSKDQKNFFIEILSIRGVGSQIGIGILNKFSISEVINAIKTQDKKLICSV
PGIGQKMSERLILELKSKFKSEILSEEEKSKDEFEIKDPEIIKMIEDLQLTLQSLSYKNK
EINTILPIIIKEIDHLGKKENSLSFEKLLKLAMHYLDEDSSNKDR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgattagttggataaatggagatttagttgatttatggcaaactaatcaaaaatctttt
gttttaataaattgtcaaggattaggatacgaaatacaaatactagaatccttttttctc
aaattaaaaacaaatcagatatctactaaaaacatcactctttggataaagcatattaaa
aaagaagattcagatttattatttggctttacatcaaaggatcaaaagaatttctttatt
gaaattttaagtattcgaggtgttggatctcaaattggtattgggatattaaacaaattt
tctattagtgaagttataaatgcaataaaaacacaagacaaaaaattaatttgttccgta
cctggtataggacaaaaaatgagtgagcggttaattttagaattaaaaagtaaatttaaa
agcgaaatattatctgaagaagaaaaaagcaaagatgaatttgagattaaggatcctgag
ataattaaaatgatagaagaccttcagttaacccttcaatcattaagttacaaaaacaaa
gaaataaatactattttgccaattattattaaagaaatagatcacctaggtaaaaaagaa
aatagtttatcatttgaaaaactattgaaattggctatgcattatcttgatgaagatagt
agtaataaagatagatga

DBGET integrated database retrieval system