KEGG   Prochlorococcus marinus AS9601: A9601_10401Help
Entry
A9601_10401       CDS       T00464                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(902600..903385)
Genome map
AA seq 261 aa AA seqDB search
MGVINLTPDSFSDGGELNSSKKVLDQVNHFLSNGVDVIDLGAQSTRPGAEEVGSSIEIKR
LIPYLKLIKSEFPDVLISIDTFNSEVAYEALLNGANWINDVTGGRRDIKILDVVSKFNCP
FVITHSRGNSQNMNQLSNYQNVLSDVKCSLDNLIKNALEKNISERNIIVDPGIGFSKDII
HNLEILRNLDAFKKWNLPILIGASRKRFIGEILNEKIPKERDIGTLAISCICSQFNVDIV
RVHNVKLNYQILKVADRIYRK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggagttattaatttaactcctgattcatttagtgatggtggggaattaaactcttca
aaaaaagttttagatcaagtaaaccatttcttgagcaatggtgttgatgttattgatctt
ggtgctcaaagtacgagacctggggctgaagaagtaggatctagtatagaaattaaaaga
ttgatcccatatctaaaattaataaaatctgaatttccagatgttttaatttctattgat
acttttaattctgaagtggcttacgaagctcttttaaatggtgctaactggataaatgat
gtcacgggaggaagaagagatataaaaattttggatgttgtatcaaaattcaattgtcca
ttcgtcataactcatagtcgtggtaatagtcaaaatatgaatcaactctctaattaccag
aatgtattgagtgatgttaagtgctcgcttgataatttaataaagaatgctttagaaaaa
aatatatctgagagaaatataatagtggatcctggaattggtttttcaaaagatatcatt
cataatttggaaatcttgagaaatttagatgcatttaaaaaatggaatttgccaattttg
ataggtgcatctaggaagagatttataggagaaattttgaatgagaaaattccaaaagaa
agggatataggaactcttgcaataagttgtatttgttctcaatttaatgttgacattgtg
agggttcacaacgtcaagctaaattatcaaatcctgaaagtagctgataggatttacaga
aaataa

DBGET integrated database retrieval system