KEGG   Prochlorococcus marinus AS9601: A9601_10401Help
Entry
A9601_10401       CDS       T00464                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A9601_10401 (folP)
Enzymes [BR:pmb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A9601_10401 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(902600..903385)
Genome map
AA seq 261 aa AA seqDB search
MGVINLTPDSFSDGGELNSSKKVLDQVNHFLSNGVDVIDLGAQSTRPGAEEVGSSIEIKR
LIPYLKLIKSEFPDVLISIDTFNSEVAYEALLNGANWINDVTGGRRDIKILDVVSKFNCP
FVITHSRGNSQNMNQLSNYQNVLSDVKCSLDNLIKNALEKNISERNIIVDPGIGFSKDII
HNLEILRNLDAFKKWNLPILIGASRKRFIGEILNEKIPKERDIGTLAISCICSQFNVDIV
RVHNVKLNYQILKVADRIYRK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggagttattaatttaactcctgattcatttagtgatggtggggaattaaactcttca
aaaaaagttttagatcaagtaaaccatttcttgagcaatggtgttgatgttattgatctt
ggtgctcaaagtacgagacctggggctgaagaagtaggatctagtatagaaattaaaaga
ttgatcccatatctaaaattaataaaatctgaatttccagatgttttaatttctattgat
acttttaattctgaagtggcttacgaagctcttttaaatggtgctaactggataaatgat
gtcacgggaggaagaagagatataaaaattttggatgttgtatcaaaattcaattgtcca
ttcgtcataactcatagtcgtggtaatagtcaaaatatgaatcaactctctaattaccag
aatgtattgagtgatgttaagtgctcgcttgataatttaataaagaatgctttagaaaaa
aatatatctgagagaaatataatagtggatcctggaattggtttttcaaaagatatcatt
cataatttggaaatcttgagaaatttagatgcatttaaaaaatggaatttgccaattttg
ataggtgcatctaggaagagatttataggagaaattttgaatgagaaaattccaaaagaa
agggatataggaactcttgcaataagttgtatttgttctcaatttaatgttgacattgtg
agggttcacaacgtcaagctaaattatcaaatcctgaaagtagctgataggatttacaga
aaataa

DBGET integrated database retrieval system