KEGG   Prochlorococcus marinus AS9601: A9601_10411Help
Entry
A9601_10411       CDS       T00464                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A9601_10411 (tpiA)
   01230 Biosynthesis of amino acids
    A9601_10411 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9601_10411 (tpiA)
   00051 Fructose and mannose metabolism
    A9601_10411 (tpiA)
   00562 Inositol phosphate metabolism
    A9601_10411 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9601_10411 (tpiA)
Enzymes [BR:pmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A9601_10411 (tpiA)
Exosome [BR:pmb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A9601_10411 (tpiA)
  Exosomal proteins of bladder cancer cells
   A9601_10411 (tpiA)
  Exosomal proteins of melanoma cells
   A9601_10411 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(903429..904154)
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAEAKSYLKEFIPLIKDINEDRKVVIAPPFTAISTFSNHSDFDYL
DISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEAVRVITRQVEQGLENTDPSNLIVAYEPIWAIGTGKTCQAED
ANKICSLIRKLIGFDDVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGASLDPNSFARIANY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgttattgctggtaattggaaaatgcacatgacttgtgctgaggctaag
tcttatttaaaagagtttatacctttaataaaagatataaatgaagatcgtaaagtagtt
attgctccaccttttactgctatttcaaccttttctaatcattctgattttgattattta
gatatttctagtcaaaatattcattgggaagatcaaggagcatttactgctgaaatatca
ccaaaaatgcttcttgaacatggtgtctcatatgcaatcgttggacatagtgaaccaagg
aaatattttagtgaaagtgatgaacaaattaataaaagagcagtttttgctcaatcaagt
ggacttactccaatagtttgtgtaggagaaacattagaacaaagagagagaggagaagct
gtaagagttattactagacaagttgaacaaggattagaaaacacagatccatctaattta
attgttgcctatgaaccaatatgggctattggcactggtaaaacatgtcaggcagaagat
gctaataagatatgttctttgattcggaaattaattggttttgatgatgtaattattcaa
tatggaggatccgttaaacctaataatattgacgaaatcatgtcaatgagtgacatagat
ggggttttagttgggggggcttcattagatccaaatagttttgcgagaattgcaaattat
caataa

DBGET integrated database retrieval system