KEGG   Prochlorococcus marinus AS9601: A9601_12081Help
Entry
A9601_12081       CDS       T00464                                 

Gene name
recD
Definition
exodeoxyribonuclease V 67 kD polypeptide (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A9601_12081 (recD)
Enzymes [BR:pmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A9601_12081 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1024556..1026259)
Genome map
AA seq 567 aa AA seqDB search
MTKTSTDIEKFQYDHIFNLILGIFKFSEKKYGNFVKDVIRILLDFEKNGETIIDVDNSLI
IFELLEDGWPNKHIHVLKTIGLIGSLHSPFVLVNRKLSLSKWSKKIERVINSFLKKIDTV
NLMNSIIFKDDNKIDEIKNIFKYSNIVFLQGGPGTGKTTLIIKLILELLQIDNFLNIGLS
APTGKATARLKEALNDKKNISFNKFLDQIEFQTLHRWILNSQNKSLKLKFKLKELDIFII
DEMSMVNIDLIESVLDLLAKDCKIILVGDKNQLSPVNNCSIWNYLFEYSDNSSIKSCVVN
LEKTYRNIGDIALISSLIFNNDFSLLNQKIKELEKDNNSKEITISKSSEKDIPKDLLFSI
TSHLKQLNISTSNLSKKKYIFDESIDNLLLNEKDLVDKIFLDLQSHLILCEKNSGIWSVE
YLNEIVFGQKKPYDLKTLKEGIPIMCTKNNNELGLSNGDIGVLIGLKNKRKYLFRKFNDN
NEEIVSLIDPSNLENVVPAIAFTIHKSQGSESEKVNILWSQNYRRNKYAVKEKKDDQNIF
CRDNFERRLFYTAVTRAKKTLNIFYLN
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacctctacagatattgaaaagttccaatacgatcatatatttaatttaatc
ttaggtattttcaaatttagtgaaaaaaaatatggaaatttcgtaaaggatgtaataaga
atcttattagattttgaaaaaaatggtgaaactattattgatgttgataatagtttaata
atctttgaattattagaagatggctggcccaataaacatatacatgttctaaaaactata
ggtttgattggttcccttcattctccattcgtattagtaaatagaaaattatccttatca
aaatggtcaaaaaagattgaaagagttattaattcattcctaaaaaaaatagataccgtt
aatttaatgaactcaataatttttaaagatgataataaaattgatgaaattaaaaatata
tttaaatattcaaacatagttttccttcaaggaggaccaggtacgggtaaaaccacttta
ataattaagttaatattagaactccttcagattgataactttttaaatattggtttgtct
gctccaactggtaaagctacagcacgtttaaaagaagctctcaatgataaaaaaaatatt
tccttcaataaatttctagaccaaatagaatttcaaactttacatagatggattttaaat
tctcaaaataaatctcttaagttgaaatttaaactaaaagagcttgatattttcataatt
gatgaaatgtcaatggttaatatcgatttgattgaatcagttttagatttgctagcaaaa
gactgtaaaattattttagttggagataaaaatcaattgtctccagtaaataactgttct
atatggaattatttgtttgaatattccgataatagttcaattaaatcttgtgtagtaaat
ttagaaaaaacttatagaaatattggagatatagcattaattagtagtttaatatttaat
aatgatttttctttacttaatcaaaagataaaagaattagaaaaagataataattcaaaa
gaaattactatttcaaagagtagtgaaaaagatatcccaaaagatctattattttcgatt
acaagtcatctaaagcagttaaatatttcaacttcaaatttaagtaaaaaaaaatatata
tttgatgagagtatagataatttattgcttaatgaaaaagatttagtagataagatattt
ctggatttacaaagtcacttgattttatgcgaaaaaaattcgggaatatggagtgttgaa
tatttgaatgaaattgtttttggtcaaaaaaaaccctatgaccttaaaactcttaaagag
ggtattcccatcatgtgtacaaaaaataataatgaactaggattgtcaaatggggatata
ggagtacttataggtttaaaaaataaaagaaaatatctttttagaaaatttaatgataat
aacgaagaaattgtctcattaattgatccatctaatttagaaaatgttgtaccagcaata
gcttttactattcataaatctcaaggaagtgaatctgaaaaagtaaacattttgtggtcc
caaaattatagaagaaataaatatgctgtaaaagaaaaaaaagatgatcaaaatatcttt
tgcagagataattttgaaagaaggttattttatactgctgttacaagagcgaaaaaaact
ttaaatatattttatttaaattaa

DBGET integrated database retrieval system