KEGG   Prochlorococcus marinus AS9601: A9601_13851Help
Entry
A9601_13851       CDS       T00464                                 

Gene name
cysQ
Definition
CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A9601_13851 (cysQ)
Enzymes [BR:pmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     A9601_13851 (cysQ)
Transfer RNA biogenesis [BR:pmb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    A9601_13851 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1153140..1154042)
Genome map
AA seq 300 aa AA seqDB search
MIELPSGVDINNLIDDIRIFSWQAADVLLYYSRLLENSDDKRNIVKNNNEDDPVTLADLK
VNELIIERINEKYKNINWDILSEENVKNSSEIFDNKTDWIWVLDPLDGTKDFIQGTGNYA
MHLALNFKQKPYIGFVLIPDKNQLWITDGKKTWCEKRDGKKYKLSLSNKKNLQEMTVVTS
KNHGNEILRNLIQKINFRKVEIMGSIGCKIASIVRGDSDIYICLSLPGKSSPKDWDFAAP
ETILKAAGGAITNLDNQELSYGKSSFEQGGIIIATNDKKTHGNICLEIKKIIEDYGIYPL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattgaattaccgtctggtgttgatattaataatcttatcgatgatataagaattttc
agctggcaagcagcagatgttttgctttattactctagattgttagaaaattcagatgat
aaaagaaatatagtcaaaaataataatgaagacgatcctgttactttggctgatttaaaa
gttaatgaattaattattgaaagaataaatgaaaaatataaaaatattaactgggatatt
ttgagcgaagaaaatgtaaaaaattcttcagaaatttttgataataagactgactggatc
tgggttcttgatcctctcgatggaacgaaggatttcatccagggaacaggtaactatgca
atgcatttggcattgaactttaaacaaaaaccatatatcgggtttgttctgattccagat
aaaaatcaattatggattacagatggaaaaaaaacatggtgtgaaaaaagagatggtaaa
aaatataaactaagtctctcaaataaaaaaaatcttcaagagatgactgtagtaacaagt
aaaaatcatggaaatgagattttgagaaatttaattcaaaaaatcaattttcgcaaagta
gaaattatgggaagcattggctgcaaaattgcatctatagtcagaggggacagtgatatt
tatatttgtcttagcttaccgggtaaaagctcaccaaaagattgggattttgctgcgcca
gaaactatcctgaaagcagctggtggggcaattacaaatttagataatcaagaactatcc
tacgggaaaagtagtttcgagcaaggaggaattataattgctacaaatgacaagaaaact
cacggaaatatttgcttagaaataaagaaaattattgaggattatggaatctatcctctt
tag

DBGET integrated database retrieval system