KEGG   Prochlorococcus marinus AS9601: A9601_14991Help
Entry
A9601_14991       CDS       T00464                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1280649..1282019
Genome map
AA seq 456 aa AA seqDB search
MICGSKTKSYLKSQNLKILGQGKLNGIVEISGAKNSALVLLASSLLTNEKIILENVPFLT
DIEKMGNILKNLGVNLVRKNNQLEIDPTTISIKELPYELVKGLRASFFCIGALLTKFGEA
QVPLPGGCNIGSRPIEEHINGLIALGAEIIIEKGIVKAKIRGNKNRLHGTHIKLNCPSVG
ATETLIMAASLAKGRTTIENAAREPEVQDLCQMLNKMGAKIYDSGKETIIIDGVNKLGGC
THKVIPDRIEAGTFLIAAAATSSSITISPVIPHHLEAVTNKLQESGSKITIKGNSISIKS
KEIKGVDIETAPFPGFPTDLQAPFTTLMTIANGESKITETIFENRMNHIYLLNEMGASIK
LNKNVAHIKGVKTINGMNLVGSDLRSSAALIIAGIIAKGSSNFYGLEHLDRGYENFELKL
KNLGVKIIREISKNTFEENGYKIESKSENLSKLGAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcggaagcaaaacgaagtcatatcttaaatcgcaaaatttaaagattcttggc
caaggcaagttaaatggaatagttgaaataagtggtgctaagaattccgccttagtttta
ttagcctcatcattgctaactaatgaaaaaataattcttgaaaatgtaccttttctcact
gatattgaaaagatggggaatatcctaaagaatctaggagtgaatttagttcgtaaaaac
aaccaactagaaatagatccaacaactatttcgattaaagaacttccatatgaacttgtt
aaaggattaagagctagtttcttttgtataggtgcactattaactaaatttggagaagct
caagtaccgttaccaggtggatgcaacattggttcaaggccaatagaagagcacattaat
ggattaatcgcactaggagcagaaattattattgaaaagggaattgtaaaggcaaaaata
agggggaacaaaaatagacttcatggcactcatattaaattaaattgtccaagtgtaggt
gcgactgaaactttaattatggcagcatctttagccaaaggaagaactactattgaaaat
gctgctagagagcctgaagttcaagatttatgccaaatgcttaataaaatgggggcaaaa
atttatgactccggtaaagaaacaatcattattgatggtgttaataagcttggcggatgt
acccataaagtaattccagaccgaatagaagctgggacttttctaattgctgctgctgca
acttcctcttcaataacaatttctccagtaatccctcatcatcttgaagctgtcactaat
aagcttcaagagagtgggagtaaaattacgattaaaggtaattctatttctatcaagagt
aaagagattaaaggagtagatattgaaacagctcctttcccaggctttcctactgatttg
caggcaccatttacaactctaatgacaatcgcaaatggtgaatcaaagataactgaaaca
attttcgaaaacagaatgaatcatatttatctacttaatgaaatgggcgccagtataaaa
ctaaacaaaaacgtagctcacatcaaaggtgttaaaacaattaatgggatgaatctagtt
ggctcagatttaaggtcatcagctgcattaataattgcaggaatcatcgcaaaaggtagt
agtaatttctatggattagaacatcttgatagaggttatgaaaattttgaattaaaacta
aaaaatttaggtgtaaaaataattagagagatcagtaaaaatacttttgaggagaatgga
tataaaattgaatctaaatctgagaatctttcaaaactcggagcagcctaa

DBGET integrated database retrieval system