KEGG   Prochlorococcus marinus AS9601: A9601_14991Help
Entry
A9601_14991       CDS       T00464                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A9601_14991 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9601_14991 (murA)
Enzymes [BR:pmb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     A9601_14991 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1280649..1282019
Genome map
AA seq 456 aa AA seqDB search
MICGSKTKSYLKSQNLKILGQGKLNGIVEISGAKNSALVLLASSLLTNEKIILENVPFLT
DIEKMGNILKNLGVNLVRKNNQLEIDPTTISIKELPYELVKGLRASFFCIGALLTKFGEA
QVPLPGGCNIGSRPIEEHINGLIALGAEIIIEKGIVKAKIRGNKNRLHGTHIKLNCPSVG
ATETLIMAASLAKGRTTIENAAREPEVQDLCQMLNKMGAKIYDSGKETIIIDGVNKLGGC
THKVIPDRIEAGTFLIAAAATSSSITISPVIPHHLEAVTNKLQESGSKITIKGNSISIKS
KEIKGVDIETAPFPGFPTDLQAPFTTLMTIANGESKITETIFENRMNHIYLLNEMGASIK
LNKNVAHIKGVKTINGMNLVGSDLRSSAALIIAGIIAKGSSNFYGLEHLDRGYENFELKL
KNLGVKIIREISKNTFEENGYKIESKSENLSKLGAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcggaagcaaaacgaagtcatatcttaaatcgcaaaatttaaagattcttggc
caaggcaagttaaatggaatagttgaaataagtggtgctaagaattccgccttagtttta
ttagcctcatcattgctaactaatgaaaaaataattcttgaaaatgtaccttttctcact
gatattgaaaagatggggaatatcctaaagaatctaggagtgaatttagttcgtaaaaac
aaccaactagaaatagatccaacaactatttcgattaaagaacttccatatgaacttgtt
aaaggattaagagctagtttcttttgtataggtgcactattaactaaatttggagaagct
caagtaccgttaccaggtggatgcaacattggttcaaggccaatagaagagcacattaat
ggattaatcgcactaggagcagaaattattattgaaaagggaattgtaaaggcaaaaata
agggggaacaaaaatagacttcatggcactcatattaaattaaattgtccaagtgtaggt
gcgactgaaactttaattatggcagcatctttagccaaaggaagaactactattgaaaat
gctgctagagagcctgaagttcaagatttatgccaaatgcttaataaaatgggggcaaaa
atttatgactccggtaaagaaacaatcattattgatggtgttaataagcttggcggatgt
acccataaagtaattccagaccgaatagaagctgggacttttctaattgctgctgctgca
acttcctcttcaataacaatttctccagtaatccctcatcatcttgaagctgtcactaat
aagcttcaagagagtgggagtaaaattacgattaaaggtaattctatttctatcaagagt
aaagagattaaaggagtagatattgaaacagctcctttcccaggctttcctactgatttg
caggcaccatttacaactctaatgacaatcgcaaatggtgaatcaaagataactgaaaca
attttcgaaaacagaatgaatcatatttatctacttaatgaaatgggcgccagtataaaa
ctaaacaaaaacgtagctcacatcaaaggtgttaaaacaattaatgggatgaatctagtt
ggctcagatttaaggtcatcagctgcattaataattgcaggaatcatcgcaaaaggtagt
agtaatttctatggattagaacatcttgatagaggttatgaaaattttgaattaaaacta
aaaaatttaggtgtaaaaataattagagagatcagtaaaaatacttttgaggagaatgga
tataaaattgaatctaaatctgagaatctttcaaaactcggagcagcctaa

DBGET integrated database retrieval system