KEGG   Prochlorococcus marinus AS9601: A9601_17661Help
Entry
A9601_17661       CDS       T00464                                 

Definition
NADH dehydrogenase I subunit N (EC:1.6.5.3)
Orthology
K05585  
NAD(P)H-quinone oxidoreductase subunit N [EC:1.6.5.3]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    A9601_17661
Enzymes [BR:pmb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     A9601_17661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1498784..1499260
Genome map
AA seq 158 aa AA seqDB search
MPLLLSGKKFHNDLKTNKCLAIFAPLEGGYETRLLRRMRAKGFKTFITSARGLGDPEVFL
LKLHGVRPPHLGHQSVGRNGALGEVQQVIPQASELFNENDKNKLLWLLEGQVLSQSELES
LIEICTNDNKLTIVVEMGGSRKLEWKPLSNYILDEFES
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgccattacttctctcagggaaaaagtttcataacgatttaaaaactaacaaatgtctc
gcaatatttgctcctcttgaaggtggttatgaaactcgtcttttgaggagaatgagggcc
aaaggctttaaaacttttataacttcagcaagagggcttggagatccagaagttttcttg
ctcaaattgcatggcgttagaccacctcaccttggtcatcaaagtgtaggaagaaacgga
gcgcttggggaagttcagcaagtaatcccacaagcttctgagttatttaatgaaaatgat
aaaaataaattactttggttattagaaggtcaagtattatcccagtctgaattagaaagc
ttaatagagatttgtactaacgataataaactaacaatagttgttgaaatggggggttca
agaaaacttgaatggaaaccattaagtaattatattttggatgaatttgaaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system