KEGG   Prochlorococcus marinus AS9601: A9601_18291Help
Entry
A9601_18291       CDS       T00464                                 

Definition
two-component response regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
pmb  Prochlorococcus marinus AS9601
Brite
Enzymes [BR:pmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     A9601_18291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1561433..1562179)
Genome map
AA seq 248 aa AA seqDB search
MSKARILVVDDEPAVLKVLVTRLQLAGYQVYSATNGEEALESFHRDSPDLIVLDVMLPKM
DGFAVCRRIRAESVVPIIFLTALEAISERVAGLDLGADDYLSKPFSPKELEARIATILRR
MGPTVSVTETKEVPSGKGVMKFGSLVVDTNRRQVSRAGDRISLTYTEFSLLELLFDEPGK
VVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEPDPRNPELILTVRGIGYASQRVG
ETATSLAS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaagaattttagttgttgatgatgaaccagcagttttgaaggtattagtt
acgaggcttcaactagcaggatatcaggtgtattcagccactaacggcgaagaagctctt
gagtcttttcacagggattccccagatttgatagttcttgatgttatgcttccaaaaatg
gatggatttgctgtttgtagaagaattagagctgaatcagtagttccaataatattctta
acagctctagaggctatttcagagagagttgctggtttggatttaggagccgatgattac
ttatctaaaccatttagcccaaaagagttagaggccagaatagctacaattttgagaaga
atggggccaactgtatcggttactgaaaccaaagaagttccttcaggcaaaggagttatg
aaatttggaagtttagttgttgatactaatcgcagacaagtttctagagctggagataga
attagtctaacttatactgaatttagtctcctagagttattatttgacgaacctggtaag
gttgttcctcgagcagaaattttggaacagctgtggggctatcctcctcgtagagcggca
gatttaagagttgtagatgtatatgttgcaagactaagaggtaaattggaaccagatcca
agaaatccagaattaatactaactgttagaggaattggttacgcatctcagagagttggc
gaaacagcaacatctttggcaagttga

DBGET integrated database retrieval system