KEGG   Prochlorococcus marinus AS9601: A9601_18961Help
Entry
A9601_18961       CDS       T00464                                 

Gene name
speB
Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A9601_18961 (speB)
Enzymes [BR:pmb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     A9601_18961 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1631137..1632018
Genome map
AA seq 293 aa AA seqDB search
MTKNLFDNENAIYMGAKRSPENCSIGIFGVNYDGTCSFKPGARFGPEAIRQVSSCLETYC
PKIKKDLEDIMYVDFGSILIDKNDSKSVIESVKSATNYLISKRLSPIMLGGEHSITRGAI
EALVKKYPDLILVQLDAHADLRESYIGNEHSHACTMKRCLEVLPEKKILQVGIRSGTKEE
FEIMHNNNQLVNFCPGGNAYELKQALLPYAKCPIYLTIDLDWFDPSLLAGTGTPEPGGFF
WNDFEEILKTLKNLRIVGSDIVELSPEIDRSGVSSIVAAKVLRSLILSLENMQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaatttatttgataacgaaaatgcaatttatatgggagcaaaaagaagtccc
gaaaattgctcaattggaatatttggagttaattatgacgggacatgttcgtttaaacca
ggagcaagatttggtccagaagcaataagacaagtcagttcttgtttagaaacatattgt
ccaaaaattaaaaaagacttagaggatattatgtatgttgattttggatcaatactaatt
gataaaaatgactcaaagtccgttattgaatcggttaaatcagcaacaaattatttaatc
agtaaacgccttagtcctattatgctcggcggcgaacactctattacaagaggtgcaatt
gaagcattagtaaaaaaatatccagatttgatattggttcaacttgatgctcatgcagat
ttaagagaatcatatataggaaatgaacatagtcatgcttgtactatgaaaaggtgctta
gaagtgctacctgaaaagaaaattttgcaagtaggaattagaagtgggactaaggaagaa
tttgaaattatgcataacaacaaccaattagttaacttttgtccaggcggaaatgcatat
gagttaaaacaagctcttcttccatacgctaagtgtccaatctatttaacaatagattta
gattggtttgatcccagtttattagcagggacgggcactccagaaccgggaggatttttt
tggaatgattttgaagagatacttaaaactttaaaaaaccttagaatcgtgggatcagat
attgtggaattatctccagaaattgatagaagcggagtaagtagcatagttgcagccaaa
gtacttagaagcttaattttgtcattagaaaatatgcaataa

DBGET integrated database retrieval system