KEGG   Prochlorococcus marinus AS9601: A9601_19131Help
Entry
A9601_19131       CDS       T00464                                 

Definition
NAD binding site:D-amino acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmb00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmb00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:pmb00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1652297..1653379
Genome map
AA seq 360 aa AA seqDB search
MKSLKENFQKARILVIGSGIIGKFNALELSELGFQVTIIDQTQLQNSSNAALGLLMGNMY
QKRKGRSWALRKQSIELWPKWITFLQKFNYELDIEKPLIQLTTNEEKFKKLETFIYENND
LNLRTLESNSIIIQNLNKAFQTKNIKGMISFKDGRVNALSLLKTLDKYLKHKKVNSLEGE
IIKIRKSNNQWISTTRNNEDIKSDMVILCNSLKAVDLIDSVSHKIKLKPVLGQAIEIDID
DAEVDLLSLPKQFSINGKNIIPKSKNKLIIGSTDEYNTKPEENVLEKLTNFLDQKPDWLM
KGKIAKKWYGIRSRPDGEPSPIMKNINDGLIICTGFYKNGILLAPACSKWVANEIQNYLS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttaaaagaaaattttcaaaaagcacgcatacttgtaattggatcagggatt
ataggaaaatttaacgctttagaattatcagaattaggtttccaagtaacaataattgat
caaactcaactccaaaatagtagcaatgcagctttaggcttactaatgggtaatatgtat
caaaaaagaaaaggtagaagttgggctctcaggaaacaaagcattgaattatggccaaaa
tggattacatttctacaaaaatttaattatgaattagatatcgaaaagccattaatacaa
ctaactactaatgaagaaaagtttaaaaaattagagacatttatttatgaaaataatgat
ctaaacttacgaactttagaaagtaactcaataataatacagaatttaaataaagccttc
caaacaaaaaatataaaaggaatgatttccttcaaagatggaagagtaaatgctttgtca
ttacttaaaacattagataaatatctaaagcataaaaaagtaaattctttagaaggagaa
ataataaaaatcagaaaatcaaacaatcaatggatttctacaacaaggaataatgaagat
ataaaatctgacatggttattttatgtaattcactaaaagcggttgatttaatagatagc
gtatcccacaagatcaaactaaaaccagttttaggacaagctattgaaattgatatagat
gatgctgaagttgatttattatcgctgccaaaacaattcagtataaatggtaaaaatata
attccaaaatcaaaaaataaactaattattggatcaactgatgaatataatactaagcca
gaagaaaatgtattagaaaaactcacaaattttctcgatcaaaaaccagattggcttatg
aaaggtaaaattgctaaaaaatggtatggaataaggtcaagaccagatggtgagccttca
ccaataatgaaaaatattaatgatggactaattatatgtactggtttttataaaaatggg
attttacttgcgccagcttgttctaaatgggttgctaatgaaattcaaaattacctttct
taa

DBGET integrated database retrieval system