KEGG   Prochlorococcus marinus AS9601: A9601_19251Help
Entry
A9601_19251       CDS       T00464                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A9601_19251 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9601_19251 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A9601_19251 (thrC)
Enzymes [BR:pmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A9601_19251 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1668615..1669718
Genome map
AA seq 367 aa AA seqDB search
MVLLNKIKNKLRINYRKKRWPGLIEAYKQYLPVTKKTPIISLNEGNTPLILSESISNLIG
NRTKVFLKYDGLNPTGSFKDRGMTMAISKAKEEGREAVICASTGNTSAAAAAYASRGGLK
PYVLIPEGFVAQGKLAQALMYGAEIISINGNFDKALEIVRDLSSEHPIELVNSVNPYRIQ
GQKTAAFEIVDDLGYAPDWLCIPMGNAGNITAYWMGFKEYSKIKSNLKLPIMMGFQSEGS
APLVKNIIVKDPETIATAIRIGNPVNREKAKKVRKESKGDFQSVTDEEIINAYKILAKEG
VFCEPASAASVAGLIKNKNRIQKESTIVCVLTGNGLKDPDCAIKNNDAIFRKNIEPSLKN
ITKILGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgttattaaataaaataaaaaataaactgcgtattaattacagaaaaaaaagatgg
ccaggtctaatagaagcttataaacaatatcttccagttacaaagaaaactcctattatt
tccctaaatgaaggaaatacaccactaatcctaagcgagtcaattagcaacttaattgga
aatagaacaaaagtttttttaaaatatgatggccttaatccaactggatcttttaaagat
cgtggaatgactatggcaattagcaaagcaaaagaagaaggacgagaagcagtaatttgt
gcaagtactggaaatacatctgctgctgctgctgcatatgcttcgagaggaggattaaaa
ccttatgttttaattccagaaggatttgttgcacaaggaaagcttgcgcaagcattaatg
tatggtgctgagataatatctattaacggaaactttgataaggctcttgaaattgttaga
gatttatcctcagaacatcctatagaacttgttaattctgttaatccatatcgaatacaa
ggacaaaaaacagcagcttttgaaatagttgatgacttaggttatgctcctgattggctt
tgtattcctatgggtaatgcaggaaacataactgcttattggatgggatttaaagaatat
tcaaaaataaaaagcaatttgaaattaccaataatgatgggttttcagtccgaaggctct
gctccattagtaaaaaatataatagttaaggatccagaaacaattgcaactgcaataaga
attggaaatcctgtaaatagagaaaaagccaaaaaagtaaggaaggagagtaaaggagac
tttcaatcagttacagatgaagaaataatcaatgcttataaaattcttgccaaagaggga
gtattttgtgaacctgccagtgcagcatcagttgctggactaattaaaaataaaaataga
attcagaaagaatcgactattgtttgtgttctgactggaaatggattgaaagatcctgat
tgcgctattaaaaataacgatgctatttttaggaaaaatattgaaccttcattaaaaaat
ataactaaaatcttaggatattaa

DBGET integrated database retrieval system