KEGG   Prochlorococcus marinus MIT 9515: P9515_01271Help
Entry
P9515_01271       CDS       T00465                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
123292..124089
Genome map
AA seq 265 aa AA seqDB search
MITSEFSLKQKNMIITRSKDKISDIKKLFTNEGAQIFDFPAIEVGYPDDFNPLDDALSEI
NDFHWIIFSSSNGIKFVDERLRNFNTSLKECSKKIKIAVVGEKTSLTLIELGIEADFVPP
EFVAESLIENFPISGYGLRVLLPRVQTGGRNLIADQFRNSGSRVVEVAAYETRCPASIPK
ETINVITKRKVDAMLFSSGKTVSNSSFLLEKEFGKEWLTFLDDAKLLTIGPQTSKICEKF
FGRVDGEAVKYTFEGLLDAAIDIFS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgataacgtctgagttctctttgaagcaaaaaaatatgatcattactcgatcaaaagat
aagatatctgatataaaaaaattattcactaatgaaggtgctcaaatatttgattttcct
gcaattgaggttggatatcctgatgattttaatcctctagatgatgcattaagcgaaatt
aatgattttcattggattattttttctagtagtaatggaataaaattcgtagatgagaga
ttaagaaatttcaatacttctctaaaagaatgttcgaagaaaattaaaattgctgtagta
ggggagaaaacttctttaactctaatcgagttaggtattgaggctgattttgtgccccca
gaatttgtagcagaaagtttaattgaaaattttcctatatcaggatatggactcagagtt
cttttgccaagagttcaaacaggaggaaggaatttaattgcagatcaatttaggaattcc
ggttcacgtgttgtggaagttgctgcttatgaaacaagatgtcctgcttcaattcctaaa
gaaacaatcaatgttattactaaaagaaaggttgatgcaatgcttttttctagtggtaaa
acagtatcaaattcttctttcttgcttgaaaaagaatttggaaaagaatggttaactttc
cttgatgatgcgaaattattaactattggtcctcaaacttcaaaaatatgtgaaaaattt
tttggcagagttgacggagaggcagtgaaatatacctttgaaggattattagatgctgct
attgatatttttagttag

DBGET integrated database retrieval system