KEGG   Prochlorococcus marinus MIT 9515: P9515_02851Help
Entry
P9515_02851       CDS       T00465                                 

Gene name
psbN
Definition
(GenBank) Photosystem II reaction centre N protein (psbN)
  KO
K02715  
PsbN protein
Organism
pmc  Prochlorococcus marinus MIT 9515
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
261588..261740
Genome map
AA seq 50 aa AA seqDB search
MQTLSSAPDPAVSVAVTILAVLLALTGFGLWTAFGPKATKLTDPWDDHDD
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttatcatccgcaccagatccagctgtttctgtagccgttacaatccttgct
gtgttattggctttaacaggttttggactatggacagcatttggtcccaaggctacaaag
ttaactgatccttgggatgatcatgatgattaa

DBGET integrated database retrieval system