KEGG   Prochlorococcus marinus MIT 9515: P9515_03201Help
Entry
P9515_03201       CDS       T00465                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(295902..296480)
Genome map
AA seq 192 aa AA seqDB search
MFFLVELSNLNIKNGLCISLGANIDSNYGKPIETFIICKPKIETLIKSWINQSKYCNKET
ESSETIFYWSSIYESSPHGVKDNQPNYLNTLVLVKSNSFPKQTTENAKFLLREFKNLERN
FGRKKTPNNMKWLSRCLDLDILWWEDFCFKDEELILPHPRFMNRNFIISPLSEVLSRTQT
VKKVEEERWLVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgttttttttagtggaattatcaaatcttaatatcaaaaatggactatgtatatcatta
ggagcaaatattgatagtaattatggaaaacctattgaaacatttataatttgcaaacca
aaaattgagactttaataaagagttggataaaccaatctaaatattgtaataaagaaact
gaatcatctgaaacaattttttattggtcttcaatatatgaatcaagtcctcatggagtc
aaggataatcaaccaaattatctaaacacacttgtcctagtcaaaagtaactctttccca
aagcaaacaacagaaaatgcaaaattccttctaagagaatttaaaaatttggaaagaaat
tttggaagaaaaaagactcccaataacatgaaatggttatctagatgtttagatttagat
attttatggtgggaagatttttgtttcaaggatgaagaattaatattacctcacccaaga
tttatgaatcgtaattttataatatctcccctttctgaagtcttaagtagaacacaaaca
gttaaaaaagttgaagaagaaagatggcttgttgattaa

DBGET integrated database retrieval system