KEGG   Prochlorococcus marinus MIT 9515: P9515_03211Help
Entry
P9515_03211       CDS       T00465                                 

Gene name
chlD
Definition
protoporphyrin IX magnesium chelatase subunit ChlD (EC:6.6.1.1 6.6.1.2)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9515_03211 (chlD)
Enzymes [BR:pmc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     P9515_03211 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
296517..298682
Genome map
AA seq 721 aa AA seqDB search
MILEKKLKGKEDIKDLMKKKDSFRAFPLAAITGHSLLKLSLLLSAVDPSLGGVVIAGGRG
TGKSVLARGLHSLIPPIEVIDNESILEKLRDNKTSLRPISRNLDPTKPEEWDENIHELIA
NMFGDDYLNQIENIPKKIIQAPFIQVPIGITEDRLVGSIDVAASLNTGEQVFQPGILAEA
HRGVLYVDDINLLDDGIVNLILEATGREQNNIERDGLSLSHPCRSLLIATYNPEEGALRD
HVLDRFAIVLSADQSIDNDQRVEITKSVLSHAENNIKFSEKWSDESDNLSTQLILARQWL
NDVKITEEQITYLVNEALRGGVEGHRSELFAVKVAKANAALRGDENVNSDDLKVAVRLVI
LPRAMQIPPEDEDIQPPPPEDQNPPPPQSSNEESEPESNENENDQEQEQQEDNSEGDEDA
TSEIPEEFILDPEACMVDPDLLLFSSAKSKAGNSGSRSVILSQSRGRYVRPLIPKGKVER
IAVDATLRAAAPYQKSRRLKNPGKTIIIEENDFRAKLLQKKAGALVIFLVDASGSMALNR
MQSAKGAVIRLLTEAYENRDEVALIPFRGNQAEVLLPPTRSITAAKRRLETMPCGGGSPL
AHGLTQSAKVAKNALSTGDIGQVIVVGITDGRGNVPLGISLGQVENENEDENVNLKQEVL
DIAAKYPMLGIKLLVIDTERKFIASGFGKELAEAAKGKYVQLPKATDKTIAAMALNAINE
F
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgattttggaaaaaaagttaaaaggaaaagaagacataaaggatttaatgaaaaagaaa
gattcttttagagcttttccattggctgcgattacgggacacagcttattaaaattatct
ttacttttatcagcagttgatcctagcttagggggagttgttatagcaggcggtagaggt
acaggtaagtcagttttagcgagaggtttacattctttaattccgccgatagaagtaata
gataatgaatcaatacttgaaaaattacgggataataagacttctttaaggcctataagt
agaaatttagatccaacaaaacctgaagaatgggatgaaaatattcatgagttaatagcg
aatatgtttggggatgattatcttaaccaaattgaaaatattccaaaaaagattatacaa
gccccatttattcaagttccaattggcattacagaagatagacttgttgggtctatagat
gttgcagcttctttaaatacaggagaacaagtttttcagccaggtatcctagctgaagct
cataggggtgtgttgtacgttgatgatattaatttattggacgatgggattgtaaattta
attcttgaagctactggtagagaacaaaataatattgaaagagatggattaagtctttct
catccatgtagatctcttttgatcgcgacttataatcccgaagaaggagctttaagagat
catgtattggatagatttgcaattgttctctctgcagatcaatctattgataatgatcaa
agagttgaaataacaaaatctgttttatctcatgcagaaaataacatcaagttttcagaa
aaatggtctgacgaatctgataatttatcaacccagttgattttggctaggcaatggttg
aatgatgtaaaaattactgaagagcaaataacttatttggtaaatgaggctttaagaggt
ggagttgaaggacacaggtctgaattatttgcagtgaaggttgccaaggcaaacgcagct
ctaagaggtgatgagaatgttaattctgatgatttaaaagtagcagtaagattagttatt
cttcctagggcaatgcaaatacctcctgaagatgaagatattcaacctcctccacctgaa
gatcaaaatccacccccacctcaatcaagtaatgaagaatctgaacctgaatcaaatgaa
aatgagaatgatcaagagcaagaacaacaagaggataattctgagggggatgaagatgct
acttcggaaattccagaagagtttattttagatcctgaagcatgtatggtagatcctgat
ttattgcttttttcatcagcaaagtctaaagcaggaaatagtggaagtaggtcagtaatt
cttagtcaaagtagaggtagatatgtccgacctttaattccaaaaggtaaagtagagaga
atcgctgttgatgcaactctaagagcagctgccccgtatcaaaaatctagaagattaaaa
aatcccggtaaaaccataatcattgaggaaaatgactttagagcaaagctccttcaaaaa
aaggcaggagcattagttatttttcttgttgatgctagtggttctatggctttgaataga
atgcaaagtgcaaaaggtgcagtaatcagacttttgaccgaggcgtatgaaaatagagac
gaagtagctcttattccttttagaggaaatcaagcagaagttcttttgcctccaacaaga
tctattaccgcagcaaaaagaagattagaaacaatgccatgtggaggtggatcgcctttg
gctcatgggttaactcaatcagccaaagtcgcaaaaaatgcactctctacaggagatatt
ggtcaggtcattgttgttggaataactgatggcagaggtaatgttccattaggcatatca
ctaggtcaagttgaaaatgaaaatgaagatgaaaatgtgaatttgaagcaagaagtttta
gatattgcagccaaatatcctatgttaggaataaagctattagtaatagatacagaaaga
aaatttattgctagtggctttggaaaagaactagcggaagctgcaaaaggaaaatatgtt
caattaccaaaagctacagataagacaattgcagcgatggctttaaacgcaatcaatgaa
ttttaa

DBGET integrated database retrieval system