KEGG   Prochlorococcus marinus MIT 9515: P9515_05311Help
Entry
P9515_05311       CDS       T00465                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.12 2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
475049..475603
Genome map
AA seq 184 aa AA seqDB search
MKNLKKLIIITGPSGVGKGTVVKQLLDSKKDIWLSISATTRNPRMGEKDGVNYYFISDEK
FKDMVDKKEFLEWAQFAGNYYGTPLSTVNEKIESGFIVLLEIEVEGAKQIKEKFPEALSI
FLLPPSDEELEKRIRNRGTEKEEAIKMRLRRAKYEIASSDRFDFVLTNYHVDETVKRIFE
IIKS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaaaaaactcattattatcacaggcccaagtggagttgggaaaggtact
gttgttaaacaacttttagatagtaaaaaagatatatggctttctatctctgcgacaaca
agaaaccccagaatgggagagaaagatggtgtgaattattactttattagtgatgaaaag
tttaaagatatggtcgataaaaaagaatttcttgaatgggctcaattcgcaggtaattat
tatggaactccactatctactgtaaatgaaaagattgaaagtggatttattgttttactg
gaaattgaagttgaaggtgccaaacaaattaaagaaaagttcccagaagctttatcaata
tttcttcttcctcctagcgatgaggaattagaaaaaagaataagaaatagaggtactgaa
aaagaagaggcaataaaaatgagacttaggagagctaaatacgaaattgcttcctcagat
agatttgattttgttttaacaaattatcatgttgatgagacagttaaaagaattttcgaa
ataattaagtcttga

DBGET integrated database retrieval system