KEGG   Prochlorococcus marinus MIT 9515: P9515_06001Help
Entry
P9515_06001       CDS       T00465                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
537838..538584
Genome map
AA seq 248 aa AA seqDB search
MTSTVPNDNLKENLGDQISNKLVSEIIRNRIKVNKKRFHANDNISDFINPGELDILQKEV
ASKVKDLLKSLVIDIDNDHNSQETAERVAKMYLKEVFKGRYQKRPDVTDFPNAKKLDEIY
TLGPISVRSACSHHMVPIIGDCWIGIKPGDKVIGISKFSRVADWVFSRPHIQEEAVMILA
DEIERLCEPKGLAILVKAKHYCMCWRGVKEPNTSMINSIVRGDFRHDISLKQEFFELVKQ
QPNALSCY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctctacagtacctaacgataatcttaaggagaatttaggcgatcaaataagcaat
aaattagtttctgaaataatcagaaatagaattaaggttaataaaaaaagattccatgct
aacgacaacatctcagatttcataaatccaggagaattagatattctacaaaaggaggtg
gcctcaaaagttaaggatttattaaagtctttagtaattgatattgataatgatcataac
tctcaagagactgctgaaagagtcgcaaaaatgtatttgaaagaagtttttaaaggtcgt
tatcaaaaaagacctgatgtcactgacttccctaatgcaaagaaattagatgagatatac
actcttggtccaataagtgtacgctctgcttgttctcatcatatggtgcctattattggt
gattgctggattgggattaagcctggagataaagttataggaatttcaaaattttctaga
gttgctgattgggttttttctagaccacatattcaagaggaagctgtcatgattcttgca
gatgaaattgaacgtttatgtgaaccaaaaggtttagcaattcttgttaaagctaaacat
tattgcatgtgttggaggggagtaaaggaacctaatacaagtatgattaattccattgta
agaggggactttagacatgatataagcctaaaacaggaattctttgagttagttaaacaa
caaccaaatgcgttatcttgttattag

DBGET integrated database retrieval system