KEGG   Prochlorococcus marinus MIT 9515: P9515_06371Help
Entry
P9515_06371       CDS       T00465                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00260  Glycine, serine and threonine metabolism
pmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
pmc01130  Biosynthesis of antibiotics
pmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9515_06371 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9515_06371 (trpA)
Enzymes [BR:pmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9515_06371 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE ThiG PcrB
Motif
Other DBs
NCBI-ProteinID: ABM71846
CyanoBase: P9515_06371
CYORF: P9515_06371
UniProt: A2BVN5
Position
570010..570849
Genome map
AA seq 279 aa AA seqDB search
MKENKKPQFTKNETLSKINEKFLELKKSKKLALMPFIMAGDPNIEKTSEILLKLQEKGAD
LIELGIPYSDPLADGPIIQFSASRALKSGTTSIKVIQLLESLKDKLRIPVILFTYFNPIL
NFGLENFCDLASKAGVAGLIIPDLPLEEASKFSEIISSYFIDLILLVAPTTPFERMKMIS
NKTKGFTYLVSVTGVTGERSKMGNRVESLITKLKEISINPVAVGFGISAPEHVNRVSKWG
ADGVIIGSAFVKRISNSNEREVVNEVGNFCEEMRKAADQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacaagaaacctcaatttactaaaaatgaaactttatcaaaaataaatgag
aagtttttggaattaaagaaaagtaaaaaattagccttgatgccttttataatggctggt
gatccaaatattgaaaaaacatcagagattttattaaagttgcaagaaaagggtgcagat
cttattgaattgggaatcccttatagtgaccctcttgcagatggaccgattatacaattt
tcagcatctagggctttaaaatcaggaactacttccataaaggttattcagttattagag
tcgcttaaagataagttacgtattccagttatactttttacttattttaatcctatctta
aattttggacttgagaatttttgtgatttagcatccaaagcaggtgttgcaggattgata
attcctgatcttcccttagaagaagcctctaaattttcggaaattattagttcttatttt
attgatttaatattattagttgcccctactacaccctttgaaagaatgaaaatgatatct
aacaaaacaaaagggtttacttatcttgtaagcgtaacaggagtaacaggagaaagaagc
aaaatgggaaatagagtagaaagtcttattactaaattaaaagaaataagcattaatcca
gtagcagttggttttggaatatccgctcctgaacatgttaatagagtcagtaaatggggg
gcagatggagtaattattggaagcgcatttgttaaaagaatttctaatagtaatgaaaga
gaagttgtaaatgaagtaggaaacttttgcgaagaaatgcgtaaagcagctgatcaataa

DBGET integrated database retrieval system