KEGG   Prochlorococcus marinus MIT 9515: P9515_06371Help
Entry
P9515_06371       CDS       T00465                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9515_06371 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9515_06371 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9515_06371 (trpA)
Enzymes [BR:pmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9515_06371 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
570010..570849
Genome map
AA seq 279 aa AA seqDB search
MKENKKPQFTKNETLSKINEKFLELKKSKKLALMPFIMAGDPNIEKTSEILLKLQEKGAD
LIELGIPYSDPLADGPIIQFSASRALKSGTTSIKVIQLLESLKDKLRIPVILFTYFNPIL
NFGLENFCDLASKAGVAGLIIPDLPLEEASKFSEIISSYFIDLILLVAPTTPFERMKMIS
NKTKGFTYLVSVTGVTGERSKMGNRVESLITKLKEISINPVAVGFGISAPEHVNRVSKWG
ADGVIIGSAFVKRISNSNEREVVNEVGNFCEEMRKAADQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacaagaaacctcaatttactaaaaatgaaactttatcaaaaataaatgag
aagtttttggaattaaagaaaagtaaaaaattagccttgatgccttttataatggctggt
gatccaaatattgaaaaaacatcagagattttattaaagttgcaagaaaagggtgcagat
cttattgaattgggaatcccttatagtgaccctcttgcagatggaccgattatacaattt
tcagcatctagggctttaaaatcaggaactacttccataaaggttattcagttattagag
tcgcttaaagataagttacgtattccagttatactttttacttattttaatcctatctta
aattttggacttgagaatttttgtgatttagcatccaaagcaggtgttgcaggattgata
attcctgatcttcccttagaagaagcctctaaattttcggaaattattagttcttatttt
attgatttaatattattagttgcccctactacaccctttgaaagaatgaaaatgatatct
aacaaaacaaaagggtttacttatcttgtaagcgtaacaggagtaacaggagaaagaagc
aaaatgggaaatagagtagaaagtcttattactaaattaaaagaaataagcattaatcca
gtagcagttggttttggaatatccgctcctgaacatgttaatagagtcagtaaatggggg
gcagatggagtaattattggaagcgcatttgttaaaagaatttctaatagtaatgaaaga
gaagttgtaaatgaagtaggaaacttttgcgaagaaatgcgtaaagcagctgatcaataa

DBGET integrated database retrieval system