KEGG   Prochlorococcus marinus MIT 9515: P9515_06611Help
Entry
P9515_06611       CDS       T00465                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9515_06611 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9515_06611 (glk)
   00052 Galactose metabolism
    P9515_06611 (glk)
   00500 Starch and sucrose metabolism
    P9515_06611 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    P9515_06611 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9515_06611 (glk)
   00524 Butirosin and neomycin biosynthesis
    P9515_06611 (glk)
Enzymes [BR:pmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P9515_06611 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(596236..597273)
Genome map
AA seq 345 aa AA seqDB search
MNFLACDLGGTKVLVGIYEKDLESDTPKLIFKKKYLSTEWDSFDSIIENFLEKECKNITW
PLHACFAIAGPVRNNAAKIINLSWNISGNDLKMKFKFESVELINDFGVLIYGIPFLQKNQ
FATIQNGEFHVSSSKNFHAIVGAGTGLGIARGFINGNNIEVLASEGGHVEFSPRSKEEWE
LKIWLKNHLKVERISCERIVSGEGLSRIAEWRLSKPDAKNHPFQKTIKELEISEESRKKI
PSQICKLSNEGDILMMEIERIWLEAYASLLGDIAVHELCFGGLWIAGGTATKHFKNFKSD
SFLKQISNKGRLIDIVKSIPIKIILDEEFGLYSAACRAKMLLKTT
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcttgcttgtgatcttgggggtacgaaagttcttgtaggtatttatgaaaaa
gatcttgaatctgatactcctaaattaatctttaaaaaaaaatatttatctacagaatgg
gattcttttgattcaataattgaaaactttctagagaaagagtgtaaaaacattacttgg
cctcttcatgcatgttttgctattgcgggtcctgtcagaaataatgctgcaaaaataatt
aatttgtcttggaatatttcaggtaatgatctgaaaatgaaattcaaatttgaaagtgtt
gaactaataaatgactttggagtattaatttatggaattccattcttacaaaaaaatcaa
tttgcaacaattcaaaatggagagtttcatgttagttccagcaaaaattttcacgcaata
gttggagcaggtacaggtctaggtattgcgaggggctttattaatggaaataatatagag
gtcctagcaagcgaaggaggtcatgtggagttctccccaaggtcaaaagaagaatgggaa
ttaaagatatggctaaaaaatcatttaaaagtggaaagaatttcttgcgaaagaattgtt
agtggtgaaggtctctcaagaatagctgagtggagattaagcaaacctgatgctaaaaat
catccttttcaaaaaactattaaagaattagaaatttctgaggaatcaagaaaaaagata
cctagtcaaatttgtaaactttcaaatgaaggggatattttaatgatggaaattgaaagg
atatggttagaagcttatgcctctttattaggagatatcgctgttcatgaactatgcttt
gggggattatggattgcaggaggtacggctacaaaacatttcaaaaactttaaatcagat
tcatttttgaaacaaatttcaaataaaggaagattaatagatattgttaaatctattcct
attaaaataattttagatgaagagtttggactttatagtgcagcctgcagagcaaaaatg
ctattaaaaacaacataa

DBGET integrated database retrieval system