KEGG   Prochlorococcus marinus MIT 9515: P9515_06841Help
Entry
P9515_06841       CDS       T00465                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00010  Glycolysis / Gluconeogenesis
pmc00620  Pyruvate metabolism
pmc00640  Propanoate metabolism
pmc00680  Methane metabolism
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
pmc01120  Microbial metabolism in diverse environments
pmc01130  Biosynthesis of antibiotics
pmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9515_06841 (acs)
   00620 Pyruvate metabolism
    P9515_06841 (acs)
   00640 Propanoate metabolism
    P9515_06841 (acs)
  Energy metabolism
   00680 Methane metabolism
    P9515_06841 (acs)
Enzymes [BR:pmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P9515_06841 (acs)
Lipid biosynthesis proteins [BR:pmc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P9515_06841 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABM71893
CyanoBase: P9515_06841
CYORF: P9515_06841
UniProt: A2BVT2
Position
620783..622765
Genome map
AA seq 660 aa AA seqDB search
MTLDKKHSINNILEEKRLFPPSKEFSEKSNIKSFEELQLLKKQSLENPMKFWESFGKSEI
DWFEPFKTVLDRENAPFFKWFKEGKLNITYNCLDRHIKNGIGNKTALIWEGEPGDSRKYT
YQELLNEVCKAANAFKSLGIKKGDLVCIYMPMIPEAMFAMLACARIGAAHSVVFGGFSSE
ALKDRLIDGSVKFVITADGGFRKDKVIELKKAVDAAIESGANEIVEKVIVVQRTKENILM
INNRDFWWHELLRDQKDWCEPEIMNSEDRLFVLYTSGSTGKPKGIVHTTAGYNLWSHLTF
KWIFDIKDDDIYWCTADVGWITGHSYIVYGPLSNGATTLMFEGVPRASNLGAFWEVIQKY
KVTIFYTAPTAIRSFMKSGREIPDQYDLRSLRLLGTVGEPINPEAWIWYRDVIGDNKCPI
VDTWWQTETGGIMISPFPGAVATKPGSASFSLPGIEVEIVNKNGEKVAKNEGGYLIVKKP
WPGMMRTIHGNSERYLESYWNFISYKNEKNVYFAGDGARIDNDGYIWIMGRVDDVISVSG
HRLGTMEIESALVSHKSVAEAAVVGRKDDLKGEVIVAFLSLEKDVKSSKELEKELKNHVV
KEIGIIAKPEQIIVSDSLPKTRSGKIMRRILRSLAAGEKINGDISTLEDSSVLEKLKKST
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacactagataagaaacattcaatcaataatattcttgaagaaaagagactcttccct
ccttcaaaagaattttcagaaaaatcaaatataaaaagttttgaagaattacaactttta
aaaaaacagtctttagagaacccaatgaaattctgggaatcctttggaaaatcggaaatt
gattggtttgaaccatttaagactgttttagaccgagaaaatgctcccttttttaaatgg
ttcaaggaaggtaaattaaatattacttataactgcttagatagacatattaaaaacggg
attgggaataaaacagcacttatatgggaaggtgagcctggggatagtaggaaatacact
tatcaagaacttctcaatgaagtatgtaaagctgcgaacgcttttaaatctttaggaatt
aaaaaaggtgatttggtatgtatttatatgccaatgattcctgaggcgatgtttgccatg
ctagcttgcgcaagaattggagctgcacattcagttgtctttgggggattctcttcagaa
gcgttaaaggatagattaatagacggaagtgtgaaatttgttattactgcagatggtggg
tttagaaaagataaggtgattgagcttaagaaagctgttgatgctgcaattgaaagtggg
gcaaatgaaattgttgaaaaagttatagttgttcaaagaactaaagaaaatattttgatg
ataaataatagggatttttggtggcatgaattattaagagatcaaaaagattggtgtgaa
cccgaaattatgaatagcgaggatagattatttgtcttgtatacttctggttctactggt
aaacccaagggaatagttcatactactgctggttataatctctggtctcacttaacattc
aagtggatttttgacataaaagatgacgatatatattggtgtacagcagatgttgggtgg
attactggtcatagttacatagtctatgggcccttatcaaatggagcaacaactcttatg
tttgagggtgttccaagggcctctaatttaggagctttttgggaagtgatccaaaaatat
aaagttacaattttctatacagcgcctacagcgataagatcatttatgaaatctggacgt
gaaattcctgatcaatatgatttaagatctttgagactgttgggtacagttggcgaacct
attaatcccgaagcatggatttggtacagagatgtaataggtgataataagtgtccgatt
gtagatacatggtggcaaacagaaactgggggtataatgattagccccttccccggggcc
gttgctacgaagccaggttcggcatcattctctttgccaggtattgaggttgaaattgta
aataaaaatggagaaaaggtagcgaaaaatgagggaggatatttaatcgttaaaaaacct
tggcccgggatgatgcgaacaattcatggtaattctgagagatatttagaaagttactgg
aattttatttcttataagaatgaaaaaaatgtttatttcgctggagatggagcacgaatt
gataatgatggatatatctggattatgggaagagtcgatgatgttataagtgtgtcagga
catcgcttgggaactatggaaatcgaatctgcactagtaagtcataaatcagttgcggaa
gctgcggttgttggaagaaaagatgatttaaaaggtgaggtaatagttgcgtttttatct
ttagaaaaggatgtcaagagttctaaggaattagagaaggaattaaagaatcacgtcgta
aaagaaattggaataattgccaagccagaacaaataatagtttcagattctcttccaaaa
acacgaagcggaaaaataatgaggagaattttaagatccttggcggcgggggaaaaaatc
aatggagatataagtacccttgaggatagttctgttttggaaaaattaaagaagagtact
taa

DBGET integrated database retrieval system