KEGG   Prochlorococcus marinus MIT 9515: P9515_09041Help
Entry
P9515_09041       CDS       T00465                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9515_09041 (tpiA)
   01230 Biosynthesis of amino acids
    P9515_09041 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9515_09041 (tpiA)
   00051 Fructose and mannose metabolism
    P9515_09041 (tpiA)
   00562 Inositol phosphate metabolism
    P9515_09041 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9515_09041 (tpiA)
Enzymes [BR:pmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9515_09041 (tpiA)
Exosome [BR:pmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9515_09041 (tpiA)
  Exosomal proteins of bladder cancer cells
   P9515_09041 (tpiA)
  Exosomal proteins of melanoma cells
   P9515_09041 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
804917..805642
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAETKNYLEEFIPLIKDLPNDRKIVIAPPFTAISTFSSYSNFDYL
DIASQNIHWEDQGAFTAEISPKMLIEHNVKYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEANRVITRQVEQGLENTDPSNLIIAYEPIWAIGTGKTCEASD
ANKICALIRELIGFDDVIIQYGGSVKPNNIDEIMSMSDINGVLVGGSSLDPISFSRIANY
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgtaatcgccggtaattggaagatgcacatgacttgtgctgaaacaaaa
aattatttggaggaatttattcctcttataaaagaccttcctaatgataggaagattgtt
attgcccctccatttacagcaatttcaactttttcgagttactctaactttgattattta
gatattgcaagccaaaacattcactgggaagatcaaggtgctttcacagcagaaatttct
ccaaaaatgcttattgaacacaatgttaaatatgcaattgttggacatagtgaacctagg
aaatatttcagtgaaagtgatgaacaaattaataagagagcagtatttgctcaatcaagt
ggtctcactccaatagtctgtgttggtgaaactcttgaacaaagagaaagaggagaagct
aatagagtcatcacaagacaagttgaacaaggattggagaatactgatccatctaatctc
ataattgcttatgaacctatatgggcgattggtaccggtaaaacttgtgaagcaagtgat
gccaataaaatatgtgctttgataagggagttaataggttttgatgatgtaattattcaa
tatggaggttctgttaagcctaataatattgacgagattatgtcgatgagcgatattaat
ggagtattggtagggggctcttctctagatccaattagtttttcaagaattgcaaattac
gaataa

DBGET integrated database retrieval system