KEGG   Prochlorococcus marinus MIT 9515: P9515_09051Help
Entry
P9515_09051       CDS       T00465                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
805626..806468
Genome map
AA seq 280 aa AA seqDB search
MQITNNNYPWPDYWGRKTSIMGIINLTPDSFSDGGEFCSTEKVLEQVNNFVSNGVDVIDL
GAQSTRPGALEIGAKKESKILIPYLKKIRSQFPSILISIDTFNSEVAHDALLNGADWIND
VTGGRRDEEILDVVSEFNCPFVITHSRGNSQNMNNLTNYDDLIRNIIDSLENLSNIATSK
NVPKDKIIWDPGMGFSKDTNQNLEILRNIDAFKNYGFPLLIGASRKRFIGDILEEDNPKE
RDIGTLAISCFCSQKNLHLVRVHNVKINYQVLKVSDQIFR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattacgaataataattatccttggcctgattattggggacgaaaaacttcaata
atggggattataaatttaactcccgattcatttagtgatggaggtgaattttgctcaact
gaaaaagttttagaacaagtaaataattttgtatctaatggagtagatgttatagatctt
ggtgctcaaagtaccagacctggtgctttagaaattggagcaaaaaaagaatcaaaaatt
ttaataccttatttaaaaaaaattagaagccaatttcccagtattctcatatctattgat
acatttaattctgaagttgctcatgacgctctcctaaatggagctgactggattaacgat
gtcactggaggtaggagagatgaggagatattagatgttgtttcagaatttaattgccct
tttgtaattactcatagtagaggaaatagccaaaacatgaataatttgacaaattatgat
gatttaataaggaatataatagattctcttgaaaatttgagcaatatagcaacaagtaaa
aatgttcctaaagataaaataatttgggatcctggtatgggattttcaaaagatactaat
caaaacttagaaattttaagaaatattgatgccttcaaaaattatgggttccctcttttg
attggtgcttctagaaaaagatttattggagatatacttgaggaagataatccaaaggaa
agagacataggaactcttgctattagttgtttttgttctcaaaaaaacttacatcttgta
agggttcataatgtaaaaataaattatcaagttttaaaagtctcagatcaaatttttagg
taa

DBGET integrated database retrieval system