KEGG   Prochlorococcus marinus MIT 9515: P9515_09061Help
Entry
P9515_09061       CDS       T00465                                 

Gene name
chlH
Definition
(GenBank) protoporphyrin IX magnesium chelatase, subunit chlH (EC:6.6.1.1)
  KO
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9515_09061 (chlH)
Enzymes [BR:pmc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     P9515_09061 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(806482..810345)
Genome map
AA seq 1287 aa AA seqDB search
MNGPVGIDLSGYLIEELRNEKNYEDFKIDIADADIFVASLIFIEDLAQKVVDAVSPYKEK
LKASIIFPSMPEVMRLNKLGSFSMAQLGQSKSIIGDLIKKKKESDGASFQDSMLKLLNTL
PSILKYLPVEKAQDARTFILSFQYWLGGTKENLKNFLLMISEKYVVTENLKDQLEEFKIQ
DPETFPDLGIWHPLAPNMFETLGEYQNWEDNRNDIKPKDNNTPTIGLVLQRSHIVTGDDA
HYVAVIQELEYRGARVVPIFCGGLDFSKPVDEFYYSTDKKSAIVDGVVSLTGFALVGGPA
RQDHPKAIDALKKLNRPYMVALPLVFQTTQEWEESDLGLHPVQVALQIAIPELDGAIEPI
ILSGRDDATGKAHTLQDRVDVIAERAIKWSTLRVKKREEKKLAITVFSFPPDKGNVGTAA
YLNVFGSIYRVLLEMKDKGYQIDDLPKNSKELMEKVINNPEAMDGSPELNIAHKMTVKEY
EEFTPYSNRLEENWGKPPGNLNSDGQNLLIYGKHFGNVFIGVQPTFGYEGDPMRLLYSRS
ASPHHGFAAYYTYVEKIWGADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGSLPNLYY
YAANNPSEATIAKRRGYASTISYLTPPAENAGLYKGLKELSELVGSYQQLRESSRGIQIV
NAIVETSKQCNLDKDVDLPMGEVDEITIEERDLFVGNIYKQLMEIESRLLPCGLHTIGEA
PTAEEAVATLVNIASLEREQEGLRSLPGLLAESINLKIEEVYDGNNKGELKFVELNEKII
KTARESIFAMVNSLKIVDGRVYLEKSLFSKLLDFLKIFGLNFPTPWLRICRLNGFNDVNQ
KELNKLFDYLLFCLEQVCADKEMDSLIKALDGNYVLPGPGGDPIRNPSVLPSGKNIHALD
PQSIPTTAAVAAAKSVVDKLIDRQKEEQGTWPETIACVLWGTDNIKTYGESLAQILWFIG
VKPKPDSVGRINKLELISLEELGRPRIDVVVNCSGVFRDLFINQMALIDQAVKLAAEAEE
PLESNFVRKHSLEQAEKEGTSIREASARVFSNASGSYSSNVNLAVENSTWEEENELQEMY
LSRKTYAFNADNPGEMNQKRDVFESVMKTADVTFQNLDSSEISLTDVSHYFDSDPTKLIK
TLREDGKEPSSYIADTTTSNAQVRTLGETIRLDSRTKLLNPKWYEGMLKSGYEGVRELSN
RLNYTLGWSATSGQVDNFVYEETNETFINDEEMRKRLMDLNPNSFRRIVGTLLEVNGRGY
WETSDENIEQLKELYQEVEDKIEGVKE
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccctgtagggatagatcttagtggttatttaattgaagagttaagaaacgaa
aaaaattacgaagattttaaaatagacatagctgatgctgacatatttgttgcttcatta
atcttcattgaagacttagcacaaaaagttgtcgatgctgtctctccatacaaagaaaaa
cttaaagcttctattatctttccctcaatgcctgaggtgatgagattaaataaattgggt
tcatttagtatggctcaacttggtcaatctaaaagtatcatcggagatcttattaaaaag
aagaaagaatctgatggtgcaagtttccaagattctatgttgaaattgctgaatacttta
ccttcaattctgaaatatttacccgttgagaaagcgcaagatgcaagaacatttatttta
agttttcaatattggctcgggggaactaaagagaatctgaaaaattttttacttatgatt
tcagaaaaatatgtagttactgaaaatttaaaagatcaattagaagagtttaaaatccaa
gatcctgaaacatttcctgatttaggaatatggcatccattagcgccaaatatgtttgaa
actcttggtgaatatcaaaattgggaagataatagaaatgatataaaaccaaaggataac
aatactccaactataggattagttcttcaaagaagtcacatcgtcactggagatgatgct
cattatgtagctgttattcaagaactagaatatcgaggggctagagtagttcctattttt
tgcggtggattagatttctctaaacctgtagatgaattttattattcaactgataagaaa
agtgcaatagtagatggggtcgtatcattaacaggatttgcactagttggtggtcctgct
agacaagatcatccgaaggctatagatgctcttaaaaagctaaatagaccttatatggtc
gcattacccttagtatttcagacaactcaagaatgggaggagagtgatttagggctgcat
cctgttcaagttgccctacaaattgcgattccagagttagacggagctattgaaccaata
attctttcaggacgtgatgacgctacaggaaaggctcatactctccaagatagagtggat
gtaattgcagaaagagcaataaagtggtccactctaagagttaaaaagagagaagaaaag
aagttagcgataactgtatttagttttcctcctgacaaaggaaatgttggtacagcggct
tatttgaatgtatttggatctatttatagagttcttttagaaatgaaagataaaggatat
caaattgatgatcttcctaaaaactcaaaagaattaatggaaaaggttattaataatcca
gaggcaatggatggttctcctgaactaaatattgcacataaaatgactgtaaaagaatac
gaagaatttacaccctactcaaatagattagaagagaactgggggaaacctccgggcaac
ttaaacagcgatggtcaaaatttacttatctacggaaaacattttggaaatgtttttata
ggagtacaaccaacatttggctatgaaggtgatccaatgagattactttactcaagaagt
gccagccctcatcatggctttgcggcttattacacctatgttgaaaaaatatggggagca
gatgcagttcttcattttggaacacacggttcacttgagtttatgcctggcaaacaaatg
ggtatgagtgaaacttgctaccccgactctttaataggatcccttccaaacttatattat
tacgcagcgaataatccatcagaagcaacaatcgccaaaagaagaggatatgcatcaact
ataagttatcttactcctcctgccgaaaatgcaggtctatataaaggtcttaaagaatta
agcgagcttgtaggctcttatcaacaattaagagaaagcagtagaggtattcaaatagta
aatgcaattgtagaaacttcaaagcaatgtaatcttgataaagatgtagatcttccaatg
ggagaggtagacgaaataactattgaagaaagagacctattcgtaggaaatatatataaa
caattaatggaaatagaaagtagattattaccttgtggactacatacaattggagaggct
ccaacagctgaggaggctgttgctaccttagtaaacatagcttcattagagagagaacaa
gagggtctaaggtctcttcctggtttattggcggaatcaataaatctaaaaatagaagaa
gtttatgacggcaataataaaggagaacttaagtttgttgaacttaatgaaaaaattatt
aaaactgccagagaatcaatatttgcaatggtcaactctttaaaaatagttgatggaagg
gtttatttggagaaatctctattttccaaattattagacttcttgaaaatctttggatta
aattttccgactccttggctgaggatctgtagattgaatggatttaatgacgtaaatcaa
aaagaattaaacaaattatttgactatttattattctgcttggagcaggtttgtgctgat
aaggaaatggatagcctcatcaaagcattagatggaaattatgtattacctggacccgga
ggagatcctattaggaacccaagtgtattaccaagtggaaaaaatatccatgcacttgat
ccacaatcaattcctaccacagctgctgtagcggcagctaaatctgttgtagataaactt
attgatagacaaaaagaagagcaaggaacttggccggagacaatcgcttgtgttttatgg
ggaacggataatatcaaaacttatggtgaatctcttgcacaaattttatggtttattgga
gttaaaccaaaacctgattctgttggaagaataaataaattagaacttatttctttagag
gagcttgggagaccaagaatagatgttgttgtgaattgttcaggcgtctttagagacctg
tttattaaccaaatggcacttattgatcaggctgtaaaattagctgcagaagcggaagaa
ccattagaatctaattttgtaagaaaacattccttagaacaagcagaaaaagaggggaca
tctataagggaagcttcagcaagagtattttctaatgcaagtggcagttatagttcaaat
gtcaatttagctgttgaaaattcgacctgggaagaagaaaatgaattgcaagaaatgtat
ttatcaagaaaaacatatgcttttaatgctgataatccaggagaaatgaaccaaaaaagg
gatgtgtttgagtctgtcatgaaaacggctgatgtaacatttcaaaacctcgactcttct
gaaatatctctaactgatgtaagtcactattttgattctgacccaactaaattaataaaa
acattaagagaggatggaaaagaacctagtagctacattgctgatacaactacttctaat
gctcaagttaggacactaggcgagactattagacttgattcaagaacaaaacttttaaat
ccaaaatggtatgaggggatgcttaaatcaggatatgaaggggttagagaactttctaat
agactaaactacacacttggatggagtgcaacaagcggccaggtagataacttcgtttac
gaagaaactaatgaaacattcatcaatgatgaagaaatgaggaagaggcttatggattta
aatcctaatagtttcagaagaattgtaggtacattattagaagttaatgggcgaggttat
tgggaaacatcagatgaaaatattgaacaattaaaagaactttatcaagaggtagaagat
aaaattgaaggagttaaagaataa

DBGET integrated database retrieval system