KEGG   Prochlorococcus marinus MIT 9515: P9515_10151Help
Entry
P9515_10151       CDS       T00465                                 

Gene name
ispE
Definition
(GenBank) Putative 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (CMK)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00900  Terpenoid backbone biosynthesis
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
pmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P9515_10151 (ispE)
Enzymes [BR:pmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     P9515_10151 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABM72222
CyanoBase: P9515_10151
CYORF: P9515_10151
UniProt: A2BWR1
Position
complement(908353..909291)
Genome map
AA seq 312 aa AA seqDB search
MTKLSTTKICVKSPAKINLHLEIIGKREDGYHELAMIMQNIDLFDYIEFENNQIGDIELK
SNNKDLSLKDDNLIIKAANYVKDISKKKDLGANIFLKKNIPIGAGLAGGSSNAAATIIGL
NKLWDLDLDNETMLSLSSKLGSDVPFFINGGCQFCFGRGEILENYNSKFDYGVILLKNPN
ISISTADTYKKYSKEYCSNFLTESEKTNDIRNDLRINGFNDLNSSNQIIKVKNDLQIIVE
KENDSVKKALYLLSNLQNCLSFSMSGSGPTCFALFKDINKANEVFEQNHKMFNNNGFEAW
VCKLINSGITFL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattatctacaactaaaatttgtgtgaaatcacctgcgaagataaacctccat
cttgaaattatcggaaaaagagaggatggatatcatgaattagcaatgataatgcagaat
attgatctttttgactatatagaatttgagaataatcaaataggtgatattgaattaaag
tctaataacaaagatttaagtctcaaggatgataacttaataataaaagcagcaaattat
gtaaaagatatatcaaaaaaaaaagatttaggagctaatatctttcttaaaaaaaatatt
cctattggtgctggtttagctggaggttccagcaatgcagccgcaacaataattggactt
aataaattatgggatttggatcttgataacgaaactatgctttcactttcctcaaaacta
ggatcagatgtacctttttttataaacggaggatgccaattttgttttggaaggggagaa
attcttgaaaattataattctaaatttgattatggcgtaatactcttaaaaaatccaaat
atttcaatctcaactgcagatacttacaaaaaatatagtaaggaatattgctcaaatttt
ttaactgaatctgaaaaaacaaatgatatcagaaatgatttgagaataaacggatttaat
gatcttaattcttcaaatcagattataaaagtaaaaaatgatttacaaattatcgttgaa
aaagaaaatgattctgtaaagaaggcattatatcttctctcaaatttgcaaaattgttta
tctttttcaatgagtggatctggcccaacatgttttgctctttttaaagatataaataag
gctaatgaagtttttgaacaaaatcataaaatgtttaataataatggatttgaagcgtgg
gtctgtaaattaattaatagtggcataacctttttgtaa

DBGET integrated database retrieval system