KEGG   Prochlorococcus marinus MIT 9515: P9515_10251Help
Entry
P9515_10251       CDS       T00465                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
916597..917283
Genome map
AA seq 228 aa AA seqDB search
MISWVKGKLVSSWQTNNKFYILINCQGLGYEIQTIESVFNELNSKNVSDKEIILWLKHIK
KEDSDSLFGFFTKDQRDFFIQILNIKGIGSQIGIALLNKFTLNQIINAISNNDKKLISSV
QGIGQKMTDRIILELKSKVFTQQIEKENLKTNNFLEENKELNSIFEDLELTLQSLNYPNK
KIKNLFPKLINDIKDNKIATLEINSISFESLLKEAMNYLDKNSSNLGQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgattagttgggtaaagggaaaattagtaagttcatggcaaactaataataaattttat
attctaataaattgtcagggattaggctacgaaattcagacaatagaatctgtttttaat
gaattaaattcaaaaaatgtttctgataaagaaattatactttggttaaaacacatcaaa
aaagaagattctgattcactttttggctttttcactaaggatcaaagagatttttttatt
caaatcctaaatattaaaggtattggatctcaaataggaattgcattattaaataaattt
actttaaatcaaataattaatgcaatatcaaataatgacaagaaattgataagttctgtt
caaggaattggacaaaaaatgacagatcgaataatacttgaattgaaaagtaaagtattt
actcaacaaattgaaaaagaaaatttaaaaacaaataattttcttgaagagaataaagaa
ttaaattcaatttttgaagatcttgagctaacacttcaatctctaaattacccaaataaa
aaaattaaaaacttgttccctaaactcattaatgatattaaagataataaaatagcgaca
ttagaaataaattccatttcgtttgaaagcttactaaaagaagcaatgaactatttagac
aaaaatagtagtaatttaggccaataa

DBGET integrated database retrieval system