KEGG   Prochlorococcus marinus MIT 9515: P9515_11881Help
Entry
P9515_11881       CDS       T00465                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1044161..1044760)
Genome map
AA seq 199 aa AA seqDB search
MTTFTKPLSKLIGHFEKFPGIGPRTAQRLALFILKQSESSIRDFSKALLEAHSNVGHCKK
CFNLTSEEECDICRNAERNQNIICVVAETKDLLALERAREFKGVYHVIGGLISPMDSIGP
EILEIRSLVERVSKSEIDEIILALTPSVEGDTTSLYIGKLLTPFTKVTRIAYGLPMGSEL
EYVDEVTLARALEGRTNLI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgacaacttttaccaaaccactttcaaaattaattggtcattttgagaaatttccagga
attggtccaaggacagctcaaaggttggcattattcattctgaaacaatctgaaagtagt
atcagagatttctccaaggcattattagaggctcatagtaatgtaggccattgtaaaaaa
tgctttaatttaacttcagaagaagaatgtgatatttgcagaaatgctgagagaaatcaa
aatataatttgtgtagtagcagagactaaagacttattagctttagaaagagctagagag
tttaagggggtataccatgttattggtggattgatttctccaatggattcaattggtcca
gagatattagaaataagaagtttagttgagagagttagtaaatcagagattgatgaaatt
atattggcattaactcctagtgttgaaggagacactactagtctttatataggaaaatta
ttaactccttttaccaaagtaacaagaattgcttatgggcttccgatgggaagcgaactt
gaatacgttgatgaagttactcttgctagagctctagaaggaagaacaaatttaatttaa

DBGET integrated database retrieval system