KEGG   Prochlorococcus marinus MIT 9515: P9515_13061Help
Entry
P9515_13061       CDS       T00465                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1148725..1149954
Genome map
AA seq 409 aa AA seqDB search
MKYITVLGSTGSIGTQTLEIVRELPNKFKVVALSAGRNIDLLTEQVSQHKPEVIAIDDEN
LLTDLKNNINNLGISNPPIVLGGREAINSVAAWDSADTVITGIVGCAGLIPTMSAIKASK
NIALANKETLIAAGSVVIPALKENKSRLLPADSEHSAIFQCIQGLPNYENADFVTGQIPN
GLKAIHLTASGGAFRDWAVEDLKNVTVEDATSHPNWSMGRKITVDSATLMNKGLEVIEAH
YLFGTPYQNIEIVIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERFRTNWKR
FNLTEIGQLTFKKPDEVKYPCMGLAYSAGKCSGTMPAVLNAANEMAVDQFLKEKISFQEI
PTFINKTCEAHINKLNLNPNLEDILEVDNWARIFVQEEIKKGKKYINVE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacatcactgtacttggttcaacaggttcaataggaacacaaactctggaaata
gtaagagaacttcccaacaaattcaaagtggtggctctttcagcagggagaaatatagac
ttattgacggagcaagttagtcagcataaaccagaagtaattgctatcgacgatgaaaat
cttttaacagatttaaaaaataatattaacaatttaggaataagtaatcctccaatagtt
ttaggtggccgagaggcaattaattcagtcgcagcatgggattctgctgataccgtaatt
actgggatagtaggatgtgctggacttattccgacgatgtcagcaattaaggccagtaaa
aatattgctcttgccaataaagaaacattaattgcagcgggctcagttgttattcctgct
ttaaaggaaaacaaaagtagacttttgcctgcagactctgagcattcagctatatttcaa
tgcatacaaggattacctaattatgaaaatgccgattttgtaacaggtcaaatcccaaat
ggtttaaaagctattcatttaacagcctcaggaggtgcttttagagattgggcagtagaa
gatttaaaaaatgtcacagtagaagatgcaacttctcatccaaattggagtatggggaga
aaaataactgtagattctgccactcttatgaacaaaggattagaagttattgaagcacat
tatctatttggtacaccctaccaaaatattgaaattgtcatacatcctcagagtatcatt
cattcaatgattgagatggaagattcttctgtcttagctcaattaggatggcctgatatg
aaactcccaattctatatgcaatgagttggccagaaagattcagaaccaattggaaaaga
tttaatttaactgagattggccaacttacatttaaaaaaccagatgaagtaaaatatcca
tgtatgggacttgcctactcagctggaaaatgttcaggaactatgcctgcagttctaaat
gctgcaaatgaaatggctgtagatcaatttcttaaagaaaaaatttcttttcaagaaatc
cctacttttataaataagacttgtgaagcacatattaataaactcaacttaaatccaaat
ttagaagatattctagaggtcgataattgggcaaggatttttgttcaagaagaaatcaaa
aaaggtaaaaaatatataaatgtagaataa

DBGET integrated database retrieval system