KEGG   Prochlorococcus marinus MIT 9515: P9515_13641Help
Entry
P9515_13641       CDS       T00465                                 

Gene name
cysQ
Definition
CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1197384..1198292)
Genome map
AA seq 302 aa AA seqDB search
MVKLPEGVDINNLIDDLRIFSWEAADILLQYSQILKKSDYKKNILKNGNEKDPVTKADLD
VNDLILKRMQSKYPSIGWKYLSEENAKADPNNCDINSDWVWILDPLDGTKDFLQGTDNYA
MHFALNFKNKPFLGVVLIPERDELWISNGVNVWCDRRQHINLKLNSFPNKSLCEMTLVTS
KNHSNPTLMNLIDKICFKNVVTMGSIGCKIASIIRGESDIYISLSLPDKSSPKDWDFAAP
EVILKTAGGAVTNLENEELCYEKANFDQAGIIIASNNKNMHSKICFQIKEIIKKYDIYPF
IT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattaccagaaggtgttgatattaataatcttatcgatgatctgagaattttc
agctgggaggctgcagatattttgcttcaatattcgcaaattcttaagaaatcagactac
aagaagaatatccttaaaaatggaaacgagaaagatcctgtaacaaaagctgatttagac
gtaaatgatttaattcttaaaagaatgcaatctaaatatccaagtatcggttggaaatat
ttaagtgaagaaaatgcaaaggctgatcctaataattgcgatatcaattctgactgggtt
tggatacttgatccgctagatggtacaaaagactttctacaaggaacagataattatgca
atgcactttgcccttaactttaaaaataaaccttttctgggagttgtcctaattccagaa
agagacgaattatggatatcaaatggtgtgaatgtttggtgcgatagaagacagcatata
aatctaaaactaaattcatttcccaataaaagtctttgtgagatgactttggtaacaagt
aaaaatcatagtaatccaaccctgatgaatttaattgataaaatttgctttaagaatgtt
gtaactatgggaagcattggttgcaaaattgcttcaataattagaggtgaaagtgatatt
tatatctctttaagcttgccagacaaaagttccccaaaggattgggattttgccgctcca
gaggtcattttaaaaacagctggtggagctgttacgaacttagaaaatgaggaactttgt
tatgaaaaagcaaattttgatcaggcaggtataattattgcctcaaataataaaaatatg
cactcaaaaatttgttttcagataaaagaaataattaaaaaatatgatatttaccctttt
ataacttag

DBGET integrated database retrieval system