KEGG   Prochlorococcus marinus MIT 9515: P9515_13641Help
Entry
P9515_13641       CDS       T00465                                 

Gene name
cysQ
Definition
CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    P9515_13641 (cysQ)
Enzymes [BR:pmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     P9515_13641 (cysQ)
Transfer RNA biogenesis [BR:pmc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    P9515_13641 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1197384..1198292)
Genome map
AA seq 302 aa AA seqDB search
MVKLPEGVDINNLIDDLRIFSWEAADILLQYSQILKKSDYKKNILKNGNEKDPVTKADLD
VNDLILKRMQSKYPSIGWKYLSEENAKADPNNCDINSDWVWILDPLDGTKDFLQGTDNYA
MHFALNFKNKPFLGVVLIPERDELWISNGVNVWCDRRQHINLKLNSFPNKSLCEMTLVTS
KNHSNPTLMNLIDKICFKNVVTMGSIGCKIASIIRGESDIYISLSLPDKSSPKDWDFAAP
EVILKTAGGAVTNLENEELCYEKANFDQAGIIIASNNKNMHSKICFQIKEIIKKYDIYPF
IT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattaccagaaggtgttgatattaataatcttatcgatgatctgagaattttc
agctgggaggctgcagatattttgcttcaatattcgcaaattcttaagaaatcagactac
aagaagaatatccttaaaaatggaaacgagaaagatcctgtaacaaaagctgatttagac
gtaaatgatttaattcttaaaagaatgcaatctaaatatccaagtatcggttggaaatat
ttaagtgaagaaaatgcaaaggctgatcctaataattgcgatatcaattctgactgggtt
tggatacttgatccgctagatggtacaaaagactttctacaaggaacagataattatgca
atgcactttgcccttaactttaaaaataaaccttttctgggagttgtcctaattccagaa
agagacgaattatggatatcaaatggtgtgaatgtttggtgcgatagaagacagcatata
aatctaaaactaaattcatttcccaataaaagtctttgtgagatgactttggtaacaagt
aaaaatcatagtaatccaaccctgatgaatttaattgataaaatttgctttaagaatgtt
gtaactatgggaagcattggttgcaaaattgcttcaataattagaggtgaaagtgatatt
tatatctctttaagcttgccagacaaaagttccccaaaggattgggattttgccgctcca
gaggtcattttaaaaacagctggtggagctgttacgaacttagaaaatgaggaactttgt
tatgaaaaagcaaattttgatcaggcaggtataattattgcctcaaataataaaaatatg
cactcaaaaatttgttttcagataaaagaaataattaaaaaatatgatatttaccctttt
ataacttag

DBGET integrated database retrieval system