KEGG   Prochlorococcus marinus MIT 9515: P9515_15511Help
Entry
P9515_15511       CDS       T00465                                 

Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pmc  Prochlorococcus marinus MIT 9515
Brite
Enzymes [BR:pmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     P9515_15511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1370567..1371535
Genome map
AA seq 322 aa AA seqDB search
MHCIHELLKEGYIVKGSLRNMKRAEEVRKSLKIDSENHKLEFCKLDLLHDEGWDEAAFDC
DYLLHVASPFTIAEPKRESLLINPALEGTIRALNASKKSSKVKKVVLTSSMAAIAYGHDK
QLCTPQDWTDTTKNVGAYVKSKTIAEKAAWDFVHNDNDHSFSMTTINPGMVFGPLLSDDI
DGASAELLSKMINGKFPALPDAYFTVVDVRDVAKLHVDSLRNNKSDNKRIIATSPQGINI
MKISKILRKNGYTKTPQKFIPTKMINSLASFNKEMKSMANMVNRGSYGADISETISIFNW
EPISLEKTLIDMGNSLKQISTK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgcactgcatccatgagctcctaaaagaaggttatatcgtaaaaggatctcttagaaat
atgaaaagagcagaggaagtaagaaaatctcttaagatagattcagaaaatcataagctg
gaattttgtaaacttgaccttctacatgatgagggttgggatgaagcagcctttgattgt
gattatcttcttcatgtcgcatctccttttactatcgcagaaccaaaaagagaatctctt
ctaatcaatcctgcattggaaggtactataagggcattaaatgcttcaaaaaaatcctct
aaagtcaaaaaagttgttctaacttcttcaatggcggcaattgcttatggacatgataag
cagttatgtacgcctcaagactggacagacacaacaaaaaacgtcggcgcttatgtaaaa
agtaaaacaattgcagagaaagctgcatgggattttgttcataatgacaatgatcattct
ttttcaatgacaactattaatcctggaatggttttcggtccactgctcagcgatgatatt
gatggggcttcggcagaacttctttcaaaaatgattaatggtaaattcccggcattacca
gatgcttattttactgtcgttgatgtaagagatgtcgctaagttgcatgtcgattctctt
agaaataataaaagtgataataaaagaattattgcgacttctccccaagggataaatatc
atgaaaatttcaaaaattttaagaaaaaatggttatacaaaaacacctcaaaaatttatc
ccaacaaaaatgataaattctcttgcgtcttttaataaagagatgaaaagtatggctaat
atggttaatagaggttcttatggtgctgatatttcagaaactatttctatatttaattgg
gaaccaatttcactagaaaaaacattaattgatatgggtaattctttaaaacaaatttca
accaaataa

DBGET integrated database retrieval system