KEGG   Prochlorococcus marinus MIT 9515: P9515_16681Help
Entry
P9515_16681       CDS       T00465                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23 1.1.1.37)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9515_16681 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    P9515_16681 (hisD)
Enzymes [BR:pmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     P9515_16681 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1462212..1463498
Genome map
AA seq 428 aa AA seqDB search
MKIINNKQKALEELKRISQRTTSGDNRKINSLVEEILEEVKINGDKAVEKYTKKFDGFHP
KPMQVSAMDLKSAWDETDHHLKKSLEIAYQRIQKFHEKEIPESFTIKGEYGDSVQRKWMP
VKNAGLYIPGGRAAYPSTVLMNAIPAKVAGVKEISMVSPGNQEGKINKTVLAAAYLSGID
KVFRIGGAQAIGALAFGTKQINRVDVISGPGNIYVTAAKKLIYGLTGIDSLAGPSEILII
ADRTAKSSQIASDLLAQAEHDPLASSILLTTSKGQAQEVFDEVFKQLEHHPRKEICIQSI
ENWGLIAICENLESCIELSNEFAPEHLEIITIDPKKILKTIENAGAIFLGNWTPEAVGDY
LAGPNHTLPTCGNARFSGSLGVETFMKNSSIIEFNEKSLKINSSDIINLANSEGLHSHAN
SVKIRFED
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagattataaataataaacaaaaggctttggaagagttgaaaagaatttctcaaaga
actacatccggcgacaatagaaaaataaattcattagttgaagaaattcttgaagaggtg
aaaattaatggagataaagctgtagaaaaatatacaaaaaagtttgatggattccatcct
aaaccgatgcaagttagtgctatggatttaaagtctgcttgggatgagacagaccatcat
ttaaaaaaatcattagaaattgcctaccaaagaattcaaaaattccatgaaaaagaaata
cctgaatcattcactataaaaggagaatatggtgactccgttcaaagaaaatggatgcct
gtaaaaaatgctggcttatacattccggggggacgagccgcatatccaagtactgtttta
atgaatgcgatacctgcaaaagttgctggagtgaaagaaatttcaatggtatctcccgga
aatcaagaaggaaaaataaataaaactgttttagctgctgcctacttatcagggattgat
aaagtttttagaattggaggagcacaggcaattggcgccttagcctttggcacaaagcaa
ataaatagagttgatgttatttctggaccaggaaatatctatgttactgctgctaaaaag
ttaatttatggattgactggaattgattctttagcaggcccaagtgaaattttaatcatc
gcggatagaacagctaaaagttctcaaatagcatcagatttattagcccaagcagagcat
gatccattagcctcctcaatacttttgactacatcaaagggtcaagctcaagaagtcttt
gatgaggtctttaagcaattagagcatcaccccagaaaagaaatttgtattcaatcaatt
gaaaattggggattaattgctatttgcgaaaatttagaatcatgcattgaactcagcaat
gagtttgccccagaacatctagagattattactattgatccaaaaaagatacttaaaact
atcgaaaatgcaggcgcgatttttttaggaaattggacaccagaagctgtaggtgattat
ttggctggaccaaaccatactttacccacatgcggtaatgccaggtttagtggatcatta
ggtgttgaaactttcatgaagaattcatcaataattgaatttaatgaaaaaagtttaaaa
atcaatagctcagatattataaacttggcaaacagcgaaggtctccatagtcatgcgaat
tcagtaaaaattagatttgaggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system