KEGG   Prochlorococcus marinus MIT 9515: P9515_17811Help
Entry
P9515_17811       CDS       T00465                                 

Gene name
ho1
Definition
(GenBank) Heme oxygenase
  KO
K21480  
heme oxygenase (biliverdin-producing, ferredoxin) [EC:1.14.15.20]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9515_17811 (ho1)
Enzymes [BR:pmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.20  heme oxygenase (biliverdin-producing, ferredoxin)
     P9515_17811 (ho1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1566983..1567693)
Genome map
AA seq 236 aa AA seqDB search
MAVALAGQLREGTKKSHTMAENTGFVACFLKGVVEKKSYRKLISDLYFVYQAMEEEIERL
VKEEHPVIKPIGFKSLFRTETLENDLKFYFGDDWKNEINISKSAEEYVKRIHLVAQTSPE
LLVGHHYTRYIGDLSGGQILKKIAKKALNLDGNNGLNFYEFKNIGDEKKFKEEYSKTLNQ
LPINQTIADEIIDEANKAFTYNMKMFKELEGNLIGVLGKIVFNYLTKKVRKGSTET
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgctcttgcaggacaattaagagaagggacaaaaaagtcccacacaatggct
gaaaatactggcttcgtagcttgttttttaaaaggcgttgttgaaaaaaaatcatataga
aaactaataagtgatttatattttgtttatcaagcgatggaagaagaaatagaaagattg
gttaaggaggaacatcctgtaataaaacctattggatttaaatcattatttagaacagaa
acacttgagaatgatctgaaattttattttggagatgattggaaaaatgaaattaatatt
tctaaatcggcagaagaatatgttaaacgaatacatcttgtggcacaaacatcgccagaa
ttattggttggccatcactatacacgatatataggagatctatctggcggtcaaatttta
aaaaaaatagcaaaaaaagctttaaatttggatggaaataatggtttgaatttttatgaa
tttaaaaatattggtgacgaaaaaaaatttaaagaagaatattctaagactttaaatcaa
ctcccaataaatcaaactattgctgatgaaattatcgatgaagccaataaagcctttact
tataatatgaaaatgtttaaggagctagagggaaacttgattggtgtattaggtaaaatt
gtttttaattacctcacaaagaaagtgaggaagggaagtacagaaacttaa

DBGET integrated database retrieval system