KEGG   Prochlorococcus marinus MIT 9515: P9515_17811Help
Entry
P9515_17811       CDS       T00465                                 

Gene name
ho1
Definition
(GenBank) Heme oxygenase (EC:1.14.99.3)
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9515_17811 (ho1)
Enzymes [BR:pmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     P9515_17811 (ho1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1566983..1567693)
Genome map
AA seq 236 aa AA seqDB search
MAVALAGQLREGTKKSHTMAENTGFVACFLKGVVEKKSYRKLISDLYFVYQAMEEEIERL
VKEEHPVIKPIGFKSLFRTETLENDLKFYFGDDWKNEINISKSAEEYVKRIHLVAQTSPE
LLVGHHYTRYIGDLSGGQILKKIAKKALNLDGNNGLNFYEFKNIGDEKKFKEEYSKTLNQ
LPINQTIADEIIDEANKAFTYNMKMFKELEGNLIGVLGKIVFNYLTKKVRKGSTET
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgctcttgcaggacaattaagagaagggacaaaaaagtcccacacaatggct
gaaaatactggcttcgtagcttgttttttaaaaggcgttgttgaaaaaaaatcatataga
aaactaataagtgatttatattttgtttatcaagcgatggaagaagaaatagaaagattg
gttaaggaggaacatcctgtaataaaacctattggatttaaatcattatttagaacagaa
acacttgagaatgatctgaaattttattttggagatgattggaaaaatgaaattaatatt
tctaaatcggcagaagaatatgttaaacgaatacatcttgtggcacaaacatcgccagaa
ttattggttggccatcactatacacgatatataggagatctatctggcggtcaaatttta
aaaaaaatagcaaaaaaagctttaaatttggatggaaataatggtttgaatttttatgaa
tttaaaaatattggtgacgaaaaaaaatttaaagaagaatattctaagactttaaatcaa
ctcccaataaatcaaactattgctgatgaaattatcgatgaagccaataaagcctttact
tataatatgaaaatgtttaaggagctagagggaaacttgattggtgtattaggtaaaatt
gtttttaattacctcacaaagaaagtgaggaagggaagtacagaaacttaa

DBGET integrated database retrieval system