KEGG   Prochlorococcus marinus MIT 9515: P9515_17811Help
Entry
P9515_17811       CDS       T00465                                 

Gene name
ho1
Definition
Heme oxygenase (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9515_17811 (ho1)
Enzymes [BR:pmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.3  heme oxygenase (biliverdin-producing)
     P9515_17811 (ho1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1566983..1567693)
Genome map
AA seq 236 aa AA seqDB search
MAVALAGQLREGTKKSHTMAENTGFVACFLKGVVEKKSYRKLISDLYFVYQAMEEEIERL
VKEEHPVIKPIGFKSLFRTETLENDLKFYFGDDWKNEINISKSAEEYVKRIHLVAQTSPE
LLVGHHYTRYIGDLSGGQILKKIAKKALNLDGNNGLNFYEFKNIGDEKKFKEEYSKTLNQ
LPINQTIADEIIDEANKAFTYNMKMFKELEGNLIGVLGKIVFNYLTKKVRKGSTET
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgctcttgcaggacaattaagagaagggacaaaaaagtcccacacaatggct
gaaaatactggcttcgtagcttgttttttaaaaggcgttgttgaaaaaaaatcatataga
aaactaataagtgatttatattttgtttatcaagcgatggaagaagaaatagaaagattg
gttaaggaggaacatcctgtaataaaacctattggatttaaatcattatttagaacagaa
acacttgagaatgatctgaaattttattttggagatgattggaaaaatgaaattaatatt
tctaaatcggcagaagaatatgttaaacgaatacatcttgtggcacaaacatcgccagaa
ttattggttggccatcactatacacgatatataggagatctatctggcggtcaaatttta
aaaaaaatagcaaaaaaagctttaaatttggatggaaataatggtttgaatttttatgaa
tttaaaaatattggtgacgaaaaaaaatttaaagaagaatattctaagactttaaatcaa
ctcccaataaatcaaactattgctgatgaaattatcgatgaagccaataaagcctttact
tataatatgaaaatgtttaaggagctagagggaaacttgattggtgtattaggtaaaatt
gtttttaattacctcacaaagaaagtgaggaagggaagtacagaaacttaa

DBGET integrated database retrieval system