KEGG   Prochlorococcus marinus MIT 9515: P9515_18131Help
Entry
P9515_18131       CDS       T00465                                 

Gene name
dedA
Definition
DedA family alkaline phosphatase-like protein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P9515_18131 (dedA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    P9515_18131 (dedA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    P9515_18131 (dedA)
Enzymes [BR:pmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     P9515_18131 (dedA)
Exosome [BR:pmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P9515_18131 (dedA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1596935..1597594)
Genome map
AA seq 219 aa AA seqDB search
MSLIFINLLTSIPEYISKAVETNSLIAYLTIGLAMFLENIIPPIPSEIIMPLGGFFVFQQ
KLNFYLLVFWGLLGTILGSIPWYYLGKLANEKRISNFLDKRGKYLGITSNDLIKSKKWFD
KYGVSLVFWGRLIPGIRTLISVPAGMELMPLRKFLIWTSLGSLIWVALLTYAGFVFGENY
QIIETYLDQIKYILKPILILIIVYLLIKFFMRLYKKNIS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaatttttattaatttactcacttccattcctgaatatatcagtaaggctgta
gaaacaaactcattaattgcttaccttacgataggtttagcgatgtttttggagaatatc
attcctccgattccctcggaaataataatgcctttaggtggattttttgttttccaacaa
aaattaaatttttatcttttggttttttggggcttattagggacgatattaggttctatc
ccttggtattatttgggtaaattagcaaatgaaaagagaatttcaaactttttagataaa
agaggaaaatatttaggaataacatctaatgatcttattaaaagtaaaaaatggtttgat
aaatatggagtttcattagttttttggggtagattgattcccgggataagaacattaatt
tcagttcctgctggaatggaactgatgcctcttagaaaattcttaatttggacgagctta
ggaagtttgatatgggttgcattattaacttatgcaggatttgtatttggtgaaaattat
caaattattgaaacttatttagatcaaattaaatatattttaaaacctatcctaattctg
ataattgtttatttgttaataaaattttttatgagactttataaaaaaaatatatcttaa

DBGET integrated database retrieval system