KEGG   Prochlorococcus marinus MIT 9515: P9515_18771Help
Entry
P9515_18771       CDS       T00465                                 

Gene name
speB
Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1665399..1666283
Genome map
AA seq 294 aa AA seqDB search
MINKNLFDKEKAIFMGSKRNPDNCSIGIFGVNYDGTCSYKSGAKFGPNAIRQVSTCLETF
CPRLEKDLEDFNYVDFGSLIIHKKDSKSVIKSVKSATNFLMSKSLAPIMLGGEHSITRGA
IEALVKKYPDLILIQLDAHADLRSSYMGNEHSHACTMQRCLDVLPEKKILQVGIRSGTKE
EFKFMRHQNQLVRFSPGGNTQELKKALIPYSNSPIYLTIDLDWFDPSLLPGTGTPEPGGF
FWNDFEAILDTLKNIRIVASDIVELSPDIDNSGVSSVVAAKVLRSLIMSLKNMQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaaatttgtttgataaagaaaaagcaatttttatggggtcaaaaagaaat
cctgataattgttcaattggaatatttggagtcaattatgatgggacatgctcctataag
tcaggagctaaatttggtcctaatgccataaggcaagttagtacatgcttagaaacattt
tgtccaagattagaaaaagatttagaagattttaattatgttgattttggctcgttaata
attcataaaaaggactcaaagtctgtcattaaatcagtcaaatcagcaacaaatttttta
atgagtaaaagcctagctcccattatgcttggaggtgaacactctattacgaggggtgct
attgaggcattagtcaaaaaatatccagatttgattttaattcaactagatgctcatgca
gatttaagaagttcatatatgggaaacgaacatagtcatgcttgtacaatgcaaagatgc
ttagatgtcttacctgaaaaaaagattttgcaagtagggataaggagtggaacaaaagaa
gagtttaaatttatgagacatcaaaatcaattagtaagattctccccaggcgggaatacc
caagaattaaaaaaggctcttattccttactctaattctccaatatatttaacaatagat
ttagattggtttgatccaagtttattacctggcacaggaactcccgaaccaggaggattt
ttttggaacgactttgaagcgattctcgacactttaaaaaacattagaatagttgcttca
gatattgtggaattatctccagatattgataacagcggagtaagtagtgtcgttgccgca
aaagtactaaggagcttaattatgtcattaaaaaatatgcaataa

DBGET integrated database retrieval system