KEGG   Prochlorococcus marinus NATL1A: NATL1_00221Help
Entry
NATL1_00221       CDS       T00467                                 

Gene name
gap2
Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase(NADP+)(phosphorylating) (EC:1.2.1.12 1.2.1.13)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NATL1_00221 (gap2)
   01230 Biosynthesis of amino acids
    NATL1_00221 (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NATL1_00221 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NATL1_00221 (gap2)
Enzymes [BR:pme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     NATL1_00221 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
24726..25748
Genome map
AA seq 340 aa AA seqDB search
MTLRVAINGFGRIGRNFMRCWLSRGANTNIEVVGINVTSDPKTCAHLLKYDSILGAIKDA
QISHTDDTFQINGKTIKCYSDRNPLNLPWKEWGIDLVIESTGVFNTDVGASKHLQVGAKK
VILTAPGKGDGVGTYVVGVNADSYSHEDFDILSNASCTTNCLAPIVKVLDQKLGINKGLM
TTIHSYTGDQRILDNAHRDLRRARAAAMNLVPTSTGAAKAVALVYPQMKGKLTGIAMRVP
TPNVSAVDLVFESGRKTSAEEVNSLLKTASQGEMKGIIKYGDLPLVSTDYAGTNESTIVD
EALTMCIDDNMVKVLAWYDNEWGYSQRVVDLAEIVAQKWK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcgtgtagcgattaatggattcggaagaattggacgcaattttatgcgttgt
tggctcagtaggggtgcaaatacaaatattgaggtggtcggcattaacgtcacttctgat
ccaaaaacttgtgcacatttgctcaaatatgactctattttaggtgctataaaagacgcc
caaatttcacatacggacgatacatttcaaattaatggcaaaactataaaatgttattca
gatagaaaccctttaaatcttccttggaaagagtggggaattgatttagtaattgagtca
actggtgtattcaatacagatgttggtgctagtaagcatctacaagttggtgctaagaag
gtcattcttactgcacctgggaagggtgatggtgtaggtacttatgtggttggtgttaac
gctgattcatactcacatgaagattttgatatccttagcaacgcaagttgcaccactaat
tgtttagcgccaatcgtaaaagttttagatcaaaagttggggattaataaaggtttaatg
accacgattcatagttatacgggagatcaaagaattcttgacaatgctcatcgtgattta
cgtcgcgcaagagcagcagcaatgaatttggtccctacttcaactggagcggcaaaggct
gttgctcttgtttatccacaaatgaaagggaaactaactggtattgcgatgcgagtccct
actcctaatgtttctgcggttgatttggtttttgaatcaggacgtaaaactagtgctgaa
gaggtcaattcattacttaaaaccgcttcacagggagaaatgaaaggaatcattaaatat
ggtgatttgcctctggtttctactgactatgcgggaacgaatgaatcaaccattgttgat
gaagcattaacaatgtgcatcgatgacaatatggtgaaagttttagcttggtatgacaat
gagtggggttacagtcaaagggttgttgatttggctgaaattgttgctcagaaatggaag
taa

DBGET integrated database retrieval system