KEGG   Prochlorococcus marinus NATL1A: NATL1_01861Help
Entry
NATL1_01861       CDS       T00467                                 

Definition
beta-N-acetylglucosaminidase (EC:3.2.1.21)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NATL1_01861
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NATL1_01861
Enzymes [BR:pme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NATL1_01861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
173742..175376
Genome map
AA seq 544 aa AA seqDB search
MNKSDLRRQVAELFIVRASGFNLDSQRLYPNLEESNSNLKRLLEEGVGGVIVLGGTVKEL
EIRCNILKKWSGKPLLLCADIEEGVGQRFYGGIKFVPPMGISQIYKKDQTLAISIAEKIG
YFTGKEAKKIGLNWLLAPVCDINNNPNNPVINLRAWGEEPETVKSLTCAFQRGVSRSKML
TCAKHFPGHGNSEVDSHLDLPEIHNDLSKLEKFELIPFKSLINQGVNSVMIGHLLFPKID
PIFPATLSKRVVTDLLRIKFKYDGLVVSDALVMNAITNKYSSGEAAVMAFDAGIDLIMMP
KDIDEAIDSLADAFYSGKISLERLNISRERRKKQLDLVSNEDDFKKEDLNNEDIKNEFLL
DASKFSNSIIKSSIFVREESTIKAEFNDINLIQIDNFDQVPNKFIPALDIPKAVGFKNLI
IHPLGISPWGKTNKKFLEMGQFSNSKILVQLFVRGKPFIGLDYHNDHWIDALKSLEIEER
LSGIIIYGCPYLFDKIKKSIHKNIPLAYSPSQTEEAQNQILSRILQSKTTQKEIDKESSI
EFTD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatctgatcttagaagacaagtagctgaattatttatagttcgagcaagtgga
tttaatcttgattcgcaacgtctataccctaacttagaggaatctaattcaaatctaaaa
agacttttagaagaaggtgttggtggagttattgttctaggaggaactgtaaaagaatta
gaaattcgttgcaatatcttaaaaaaatggtctggtaaacctcttcttttatgtgctgac
attgaggaaggtgttggtcaaagattttatggaggaataaagtttgttcctccaatgggt
atttctcagatttataaaaaagatcaaactttagcaatttctattgctgagaaaattggt
tattttactggtaaagaagcaaaaaagattggtttaaattggctattagccccagtctgt
gatattaataacaatccaaataacccagttataaatctaagagcttggggagaagagcct
gaaacagtaaaaagtttaacttgtgcttttcagcgcggtgtttctagatcaaaaatgctg
acttgtgcgaaacattttcctgggcatggaaattctgaagttgactctcacttggatttg
ccagaaatacataatgacttatctaaattagagaaatttgagttaattccatttaagtct
ttaatcaatcaaggagtaaatagtgtcatgatcgggcatttactttttccaaagattgat
cctatttttcctgcaacactttcaaaaagagtggttactgatttgttacgtatcaaattt
aaatacgatggtttagtagtcagtgatgccttagttatgaatgcaataacaaataaatat
agtagtggtgaggctgcagttatggcatttgatgcaggaattgatttgattatgatgcca
aaagatattgatgaggcaattgattctcttgccgatgctttttattcaggaaaaatttct
ttagaaaggttaaatatatctagagaaagaagaaaaaaacaacttgatttagttagcaac
gaagatgattttaaaaaagaagatttgaacaatgaagatattaaaaatgaatttttattg
gatgcttctaaatttagtaattctataataaaaagttcaatttttgtccgagaagaaagt
actataaaagctgaatttaatgatataaatcttatacaaattgataattttgatcaagta
cctaataaatttattcctgcattagatatccctaaggcagtaggttttaaaaatttaatt
atacatccacttggtatcagtccgtggggaaaaactaataagaaatttttagaaatgggg
caatttagcaatagtaagattcttgttcagctttttgtgagaggtaaaccatttattgga
ttagattatcataatgatcattggatagatgcactaaaaagtttagaaattgaggaaaga
ttatcaggaattataatttatgggtgtccatatttatttgataaaataaaaaaatctatt
cataaaaatattcctttagcttatagccctagtcaaacagaggaagcacaaaatcaaatt
ttaagtcgtattttgcaatcaaaaacaactcaaaaggaaattgataaagaatcaagcata
gaatttactgattga

DBGET integrated database retrieval system