KEGG   Prochlorococcus marinus NATL1A: NATL1_01871Help
Entry
NATL1_01871       CDS       T00467                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NATL1_01871 (hemD)
Enzymes [BR:pme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NATL1_01871 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
175478..176263
Genome map
AA seq 261 aa AA seqDB search
MALTDKKIIITRALEQTSEAREIFRKNGAEVFDLPSLVIGPPDDWEPLDGALKEITTFDW
IIFSSANGVRNVDERMKEIGLSLSEISENIQIAAVGRKTASLLEDMDVKVSFVPPSFVAD
SLVEYFPQNQKGLKLFIPRVQTGGRSILSDSFKLKGAEVTEVAAYESSCPKDIPQKTIDA
LNSGQIDIIAFTSSKTVKNTVSLFTKHFGENWLKLIQKIQLVSIGPQTTISCKNLIRKPD
KEASPHDLEGLLQACLELNFN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaccgacaagaagataattattactcgtgccctagaacagacttcagaggct
cgtgagatctttcgaaaaaatggagctgaggtattcgatcttccttcattagtgattggt
cccccagatgactgggagcctctagatggtgccttaaaggaaattactacctttgactgg
atcatcttttctagtgcaaatggtgttagaaatgttgatgaaagaatgaaagaaattggc
ttatctttgtcggaaatttctgagaatattcaaattgcagctgtaggaagaaaaacagcc
tctttgttagaagatatggatgtaaaggttagttttgttcctcctagttttgttgcagat
agcttggttgaatattttcctcagaatcaaaaaggtttaaaattatttattcccagagta
caaaccggcggtagatcaatattatctgactctttcaaattaaaaggagcagaggtgacg
gaagtagctgcttatgaatcttcttgtcctaaagatattcctcaaaagactatagatgct
ttgaatagtggacaaatagatattattgcttttactagtagtaaaacagtaaaaaatact
gtcagcttatttacaaaacactttggtgaaaattggttgaagttgattcaaaagattcaa
cttgtttcgattgggcctcaaacaactattagctgtaaaaaccttattagaaagccagac
aaagaggcttctccgcatgatttggaaggattattgcaagcttgtttagaactgaatttt
aattaa

DBGET integrated database retrieval system