KEGG   Prochlorococcus marinus NATL1A: NATL1_02381Help
Entry
NATL1_02381       CDS       T00467                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NATL1_02381 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NATL1_02381 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NATL1_02381 (trpB)
Enzymes [BR:pme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NATL1_02381 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(220171..221424)
Genome map
AA seq 417 aa AA seqDB search
MTGTLPTQFKDSDLSPLTRPNALGRFGKYGGQYVPETLIPALIELEQAAKEAWKDSSFNS
ELNHLLKTYVGRSTPLYEATRLTEHYRKNTLKGPRIWLKREDLNHTGAHKINNALGQALL
AIRMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGKEDMRRQALNVFRMQLLGASVR
PVTSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEETKQQCK
QAFGRSPDVLLACVGGGSNAMGLFHSFVEDKSVRMIGVEAAGDGVETGRHAATITEGRVG
VLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPEHSYLKEIGRAEYAAVTDTEAIEALQ
LVSKLEGIIPALETAHAFAYLEKLCPTLNHNSEIVINCSGRGDKDVNTVAEKLGSEI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtacactcccaacacaatttaaagattcggatttatctcctttaacaaggcca
aatgctcttggtcgatttggtaagtatggggggcaatatgttcctgaaactttaatacct
gctcttattgaattagagcaagctgctaaagaagcatggaaagattcttcattcaattca
gaactaaatcatttactaaaaacatacgtaggaagatcaactcctctttatgaagccaca
agactaactgaacattacagaaaaaatacattaaaaggtccaaggatttggcttaaaaga
gaagatttaaatcacacaggcgcacacaaaataaataatgcacttgggcaagctcttctt
gcgattcggatgggaaaaaaaagaattattgctgaaactggggctggtcagcatggagtt
gcaactgcgacagtctgcgctcgttttggattggagtgcattatctatatgggcaaagaa
gatatgagaagacaagccttaaacgtattccgaatgcaattgcttggagcctcagtgagg
ccagtaacaagtggaacagcaacactcaaagatgcaaccagcgaagctattcgggattgg
gttactaatgttgaaacgactcattatattctcggttcagttgcaggcccacatccatat
ccaatgttggtcagagattttcacgcagttattggagaagaaacaaagcaacaatgtaaa
caagcttttgggcggtctcccgatgttcttcttgcttgtgttggtgggggatcgaatgcg
atgggtcttttccattcttttgttgaagacaaaagtgtgagaatgattggagttgaagct
gcgggagatggagtcgaaacaggtcgccatgcagcgacaattactgaaggaagagtagga
gttctccacggcgcgatgagtctcttactacaagacaaagatgggcaagttgaggaggct
cattccattagcgcaggtcttgattatccaggggttgggccggagcatagttacttaaaa
gaaattggacgtgctgaatatgctgctgttactgacactgaagccatagaagcgctgcaa
ttagtgagtaaattggaaggtattattcctgctctagagactgctcatgcatttgcctat
ctagaaaaactttgcccaactctcaatcataattctgaaattgtcattaactgctctggc
agaggggataaagacgtgaatacagttgctgaaaagctaggatcagaaatataa

DBGET integrated database retrieval system