KEGG   Prochlorococcus marinus NATL1A: NATL1_02931Help
Entry
NATL1_02931       CDS       T00467                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NATL1_02931 (hemB)
Enzymes [BR:pme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NATL1_02931 (hemB)
Exosome [BR:pme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NATL1_02931 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
272024..273022
Genome map
AA seq 332 aa AA seqDB search
MDLTYRPRRLRRTNSLREMVRENTVSASDFIYPLFVHEGSDTQEIAAMPGTSRWPIDGLI
DEVKRAWNLGIRCVVIFPKVPDEQKTEDGAECFNEKGLIPRTIERLKKEIPEMCVMTDVA
LDPYSCDGHDGIVSDDGIILNDATVNYLCKQAVVQARAGADLIGPSDMMDGRVGAIREAL
DDEGFEHVGIISYTAKYSSAYYGPFREALDSAPRSISNKPIPKNKNTYQMDPANAREAIT
EAQLDEQEGSDILMVKPGLAYLDIIYRLREESELPIAAYNVSGEYSMVKAAAQRGWIDER
EIVLETLLSFKRAGANLILTYHACDAAGWLKE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatcttacttatcggccccgtcgtcttcgcagaacaaactctttaagagagatggtt
cgagagaacactgtctctgcttctgactttatttaccctctttttgttcatgaaggttca
gatactcaagaaatagccgcgatgccaggtacaagtcgctggcccatagatggattgatt
gatgaagttaagcgtgcttggaatctaggtattagatgtgtcgttatttttccaaaagtt
cctgacgagcaaaaaacagaagatggagctgaatgctttaatgaaaaaggtttaatacca
aggactattgaaagattgaaaaaagagataccggaaatgtgtgttatgactgatgttgct
ttagatccttattcttgtgatggtcatgatggaatagttagtgatgacgggataattttg
aatgatgcaactgttaattatttgtgtaaacaagctgttgttcaggcacgagctggagca
gatttaattggcccaagtgacatgatggatggaagagttggagcaataagagaagcctta
gatgatgaaggttttgaacatgtaggaataattagttatacggcaaaatattcatctgca
tattatggaccgtttagagaagctttagattctgctcctagatcaatatctaataagcct
attccgaaaaataaaaacacctatcagatggatccagctaatgctagggaagcaataact
gaagctcagcttgacgaacaagaaggatcagacatcctcatggttaaaccaggtttggct
tacttagatattatttaccgtttaagagaagaatcagaactacctatcgctgcgtataac
gtaagtggggagtactcgatggtcaaagctgctgctcaaagaggctggatagatgaaaga
gaaattgttttggaaactttattgagttttaaaagagcaggagcaaatctgatccttaca
tatcacgcatgtgatgccgcaggatggttaaaagaataa

DBGET integrated database retrieval system