KEGG   Prochlorococcus marinus NATL1A: NATL1_04641Help
Entry
NATL1_04641       CDS       T00467                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NATL1_04641 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NATL1_04641 (murE)
Enzymes [BR:pme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NATL1_04641 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
425023..426552
Genome map
AA seq 509 aa AA seqDB search
MSRYLHTLLKAIDLQVRSGLANPEIKNLSTDSREIEKGDLFLGLDGEKVDGGTFWAKAIE
RGACAAIISKKASLLNPPTNEDPVVILPEPVSLFMGKLAADFWGKPSSEICLIGITGTNG
KTTTSFLIEFLTTSLGHPSALFGTLINRWPNYEETSKYTTTFAVPLQAKLRKAVQAGVEY
GAMEVSSHALSQNRVAGCDFNGAIFTNLSRDHLDYHDSMESYFEAKASLFRSHLIDDDGP
RSVINIDDKWGSILAKELNKKCWTCSLKENSQIREKPDLYISNLQIMQDGYMGKLHTPFG
VGNFISPLIGEFNLMNMLQAIGILVQRGLPLNDLLEALNKFPGVPGRMQLINMDGFKVKD
GYPLVIVDYAHTPDGLQNALIASRSLTKKRLICVFGCGGDRDKGKRSKMGEVAAKFADYI
VVTSDNPRQEDPIEIIKDIQKGITIDSEISVEPERSIAIQFAIAKAKKNDVVLIAGKGHE
DYQILKDQTIYFDDREQARKALSLRTDVI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcgttatctgcacactttgttgaaagcaattgatcttcaggtccgttcagggtta
gcaaatccagaaataaaaaatctgtccactgattctagagaaattgaaaaaggtgatttg
ttcttaggtttagacggtgaaaaagttgatggggggaccttttgggcaaaagcaattgag
agaggtgcttgtgcagccattattagtaaaaaggcttctcttttaaatccgccaactaac
gaagaccccgtagttattctcccagagcctgtatcactatttatgggtaaattagctgca
gatttttggggtaagccatctagtgagatttgtttgataggtattactggtactaacgga
aaaacgactacatcatttttaattgaatttctgactacttcgcttggccatccatccgct
ttgtttggaacattaattaatagatggcctaactatgaggaaacttcaaaatatacaact
acttttgcggtccctttgcaggcaaaacttaggaaagccgttcaggcaggagttgaatat
ggagcaatggaagtaagttcacatgcgttgtctcagaatagagtcgctggttgtgatttc
aatggggcaatatttacaaacctttcaagagaccatttagattatcacgattcaatggaa
tcttattttgaggctaaagctagtttgttccgatcacatctgatagacgatgatggtcct
agatcagtaattaatatagacgataaatggggttcaatattagcaaaagagctcaacaaa
aaatgttggacatgttcattaaaagagaactcccaaatcagagagaaaccagatttatat
attagcaatcttcaaattatgcaagacggatacatgggaaaattgcatacgccatttggg
gtgggaaattttatttcaccactaataggtgagtttaatttaatgaatatgttgcaagca
ataggaattttagttcaaaggggactcccattaaatgatcttttagaagctttaaacaag
ttccctggagtgccagggagaatgcaactgataaacatggatggatttaaagtaaaagac
ggctatccactagtgatagtagattatgctcatacaccagatggtttacaaaatgcttta
atcgcatcgagatcattgacgaaaaaaagattaatttgtgtctttggttgtggtggtgat
agagataaaggtaaaagatctaagatgggggaagttgctgctaagtttgcagattatata
gttgtgacatctgataatcctcgacaagaagacccaatcgaaattattaaagatattcaa
aagggtataacaattgattctgaaatttctgttgagccagagagatccattgcaattcaa
tttgccatagcaaaagccaagaaaaatgatgttgttttaatcgcagggaaaggtcatgag
gattatcaaattctaaaagatcagacaatttattttgacgatcgtgaacaagctagaaaa
gcactatctttaagaacagatgttatttga

DBGET integrated database retrieval system