KEGG   Prochlorococcus marinus NATL1A: NATL1_05221Help
Entry
NATL1_05221       CDS       T00467                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.12 2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NATL1_05221 (gmk)
Enzymes [BR:pme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NATL1_05221 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
475386..475946
Genome map
AA seq 186 aa AA seqDB search
MSSLGNLTVLTGPSGVGKGTIVRKILESHSDVWLSISATTRQPRSGEIEGEHYFFLEKKK
FQEIIDKDGFLEWASFSNNFYGTPKKIVKEKIEKGTNVLLEIELEGARQIRKSFPEAFQI
FLAPPNLYELEKRIRGRGTETEESIRDRLSIAEKELIAQKEFDAVVINEDIEKAFKEIEG
FMGLKL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctttaggaaatcttactgttcttactggcccaagcggggtgggtaaaggaaca
attgttaggaaaatccttgaaagtcatagtgatgtatggctttctatttctgctactact
cgtcagccaagatctggagaaattgagggagagcattacttcttcttagagaaaaaaaaa
tttcaagaaataattgataaagatggtttcctagagtgggcttcattctctaataatttt
tatggaactccaaaaaaaatagttaaagaaaaaattgaaaagggaacaaatgtccttctt
gaaattgaattagagggtgctcgacaaattcgaaagtcttttccggaggcatttcaaata
tttttagcaccaccaaatttatatgaacttgaaaaaagaattagaggaagaggaactgaa
acagaagaatctattagagatcgtttgtccatagctgaaaaagaacttattgcccaaaaa
gagtttgacgctgtagttattaatgaagatatagaaaaagccttcaaggaaattgaaggc
tttatgggattaaaactttaa

DBGET integrated database retrieval system