KEGG   Prochlorococcus marinus NATL1A: NATL1_05221Help
Entry
NATL1_05221       CDS       T00467                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00230  Purine metabolism
pme01100  Metabolic pathways
Module
pme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NATL1_05221 (gmk)
Enzymes [BR:pme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NATL1_05221 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 MMR_HSR1 RsgA_GTPase AAA_33 NTPase_1 Intein_splicing AAA_17 AAA_22 AAA_29 AAA ABC_tran NB-ARC AAA_30 cobW
Motif
Other DBs
NCBI-ProteinID: ABM75084
CyanoBase: NATL1_05221
CYORF: NATL1_05221
UniProt: A2C0S4
Position
475386..475946
Genome map
AA seq 186 aa AA seqDB search
MSSLGNLTVLTGPSGVGKGTIVRKILESHSDVWLSISATTRQPRSGEIEGEHYFFLEKKK
FQEIIDKDGFLEWASFSNNFYGTPKKIVKEKIEKGTNVLLEIELEGARQIRKSFPEAFQI
FLAPPNLYELEKRIRGRGTETEESIRDRLSIAEKELIAQKEFDAVVINEDIEKAFKEIEG
FMGLKL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctttaggaaatcttactgttcttactggcccaagcggggtgggtaaaggaaca
attgttaggaaaatccttgaaagtcatagtgatgtatggctttctatttctgctactact
cgtcagccaagatctggagaaattgagggagagcattacttcttcttagagaaaaaaaaa
tttcaagaaataattgataaagatggtttcctagagtgggcttcattctctaataatttt
tatggaactccaaaaaaaatagttaaagaaaaaattgaaaagggaacaaatgtccttctt
gaaattgaattagagggtgctcgacaaattcgaaagtcttttccggaggcatttcaaata
tttttagcaccaccaaatttatatgaacttgaaaaaagaattagaggaagaggaactgaa
acagaagaatctattagagatcgtttgtccatagctgaaaaagaacttattgcccaaaaa
gagtttgacgctgtagttattaatgaagatatagaaaaagccttcaaggaaattgaaggc
tttatgggattaaaactttaa

DBGET integrated database retrieval system