KEGG   Prochlorococcus marinus NATL1A: NATL1_06271Help
Entry
NATL1_06271       CDS       T00467                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NATL1_06271 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NATL1_06271 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NATL1_06271 (trpA)
Enzymes [BR:pme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NATL1_06271 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
570379..571179
Genome map
AA seq 266 aa AA seqDB search
MKSTNISRSFSKIKKEKRIALMPFLMAGDPDLETTAKILLELQANGADMIELGIPYSDPL
ADGPIIQLAASRALSAGTSPDRVFKMLFELRDQLKIPIILFTYSNPLINKGLEEFCWQAS
KVGVSGLVVPDLPLEEAEKLSDIAESKEIDLVLLVAPTTPKDRMKKIAATSNGFTYLVSV
TGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIEQVREWGADGAIVGSALVK
RIANASIEMKVEEAGSFCKELRAATN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtacaaatatcagtaggtctttttccaaaataaaaaaggagaaaagaattgca
ctaatgcctttccttatggcaggtgaccctgatttggaaactacagcaaagattttgtta
gagcttcaggcaaatggcgctgacatgattgagctaggcattccatacagtgatccttta
gcagatggtccgattattcaattagcagcttctcgagctctctctgcaggaacctcccct
gacagggtttttaaaatgttgtttgaattgagagatcaattgaaaataccaataatttta
tttacttactcaaacccacttattaataaaggtctggaagaattttgctggcaagcatcg
aaagtaggtgtttcaggacttgtcgtaccagatcttcctctagaggaagcagaaaaactt
tctgatattgctgaatctaaggaaattgatttggttttacttgttgctcctacaacccca
aaggatcgtatgaaaaaaatcgcagcgacttctaatggattcacttatcttgtaagtgtt
actggggtaactggagaaaggtcatcattagaagataatgtaggatctcttgtgcaacaa
ctaaaagattcttcatctagtccaattgctgtgggctttggaatttcggatgtaaaacac
attgaacaagttagagaatggggcgctgatggcgcaattgttggtagtgctttagttaaa
agaattgctaatgcctcgatcgaaatgaaagtcgaagaagctggttctttttgtaaagaa
ctaagagccgcaactaattaa

DBGET integrated database retrieval system