KEGG   Prochlorococcus marinus NATL1A: NATL1_06781Help
Entry
NATL1_06781       CDS       T00467                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00010  Glycolysis / Gluconeogenesis
pme00620  Pyruvate metabolism
pme00640  Propanoate metabolism
pme00680  Methane metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01120  Microbial metabolism in diverse environments
pme01130  Biosynthesis of antibiotics
pme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NATL1_06781 (acs)
   00620 Pyruvate metabolism
    NATL1_06781 (acs)
   00640 Propanoate metabolism
    NATL1_06781 (acs)
  Energy metabolism
   00680 Methane metabolism
    NATL1_06781 (acs)
Enzymes [BR:pme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NATL1_06781 (acs)
Lipid biosynthesis proteins [BR:pme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NATL1_06781 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABM75238
CyanoBase: NATL1_06781
CYORF: NATL1_06781
UniProt: A2C178
Position
624414..626390
Genome map
AA seq 658 aa AA seqDB search
MNSNNSNSIESVLQEQRVFPPSDNFSSKSRISSFSKYLEMSEMAKSDPNKFWGDAAREEL
HWFKSFNKVLDWSNPPFAKWFDGGKTNISFNCLDRHLNSSTADKVALIWEGEPGDKKKYT
YKQLHKEVCKAANALKSIGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSSE
ALRDRLINGEAKAIITADGGFRKDKVIPLKDAVDQALEGCACPKVESVLVVQRTKKNIVM
DDGRDYWWHEIVDSQADDCLPEQMDSEDCLFVLYTSGSTGKPKGVVHSTAGYNLWSHLTF
KWIFDIRENDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGVPRPSNPGAFWDVIQKH
KISIFYTAPTAIRAFMKAGNKIPNQYDLSSLRLLGTVGEPINPEAWIWYRDVIGGGRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATFPLPGIEADVVNSDGDSVAINEGGYLVVKRP
WPGMMRNVYGDEKRFRESYWEYLKPSDNSYMYFAGDGARRDEDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHELISEAAVVGRPDDLKGESIVAFVTLKTGAEANENIEAQLKKHVV
NEIGPIAKPDEFKFTDSLPKTRSGKIMRRILRALASGDEISGDTSTLEDRSVLDKLRS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaacaattctaactctattgagtctgttcttcaggagcagagagttttcccc
ccatctgataacttttccagtaaaagtaggatctcatctttttcaaagtatttggaaatg
tctgagatggccaaatcagatccaaataagttttggggtgacgcagctagagaagaatta
cactggtttaaatcttttaataaagtactcgattggtccaatccaccattcgctaaatgg
tttgatggaggaaaaacgaatatttcctttaactgcttagatcgtcacttaaatagttca
acagctgacaaagtcgccttgatttgggaaggtgagccaggtgataagaaaaaatatacc
tacaaacaactacacaaagaagtatgcaaagcagccaatgcactcaagtctataggtata
ggtaaaggagatcttgtcgctttgtatatgcctatggttcccgaagctgcaattgcaatg
cttgcatgtgcaaggattggagctccgcattcagtagtatttggaggcttttcctctgag
gcactaagggaccgactaattaatggagaagcgaaagcaataattacagctgatggtggt
tttagaaaagataaagtaattcctctcaaagatgcggttgatcaagcattggaaggttgt
gcttgtccaaaggtcgaatcagttttagttgttcaaaggacaaaaaaaaatatcgtcatg
gatgatggtagagattattggtggcatgaaattgtagacagtcaagcagatgattgtttg
ccggaacaaatggatagtgaggattgtttatttgttttgtatacctcaggctctacaggc
aaaccaaagggagtagttcattcaacagctgggtataacctttggtctcatttaactttt
aaatggatttttgatattcgtgaaaatgatgtttattggtgcacagctgatgtgggttgg
ataaccggacatagttatatcgtttatggtccactatctaatggtgcaaccactgttatg
tatgaaggagttcctagaccatcaaatccaggagctttttgggatgtaattcagaagcat
aaaatttcgattttttacactgctccaactgctataagggcttttatgaaagcgggtaac
aagattcctaaccaatatgatttatctagtttgaggcttttaggaactgttggagagcct
attaatccagaggcttggatatggtatcgggatgttattggaggaggtcgatgcccgata
gttgatacatggtggcaaacagaaactggaggagtgatgattagccctcttcctggggcg
acgccaacgaaacctggatcagcaactttccctttacccggaattgaagccgatgtagtc
aattcagatggggattctgtcgctattaatgagggtggatatttggtagttaaaagacct
tggcctggaatgatgaggaatgtttatggagacgaaaaaagatttagagagagttactgg
gagtatttaaaaccttcagataatagctatatgtattttgctggagatggggctcgaaga
gatgaagatggttatttttgggttatggggagagttgatgatgttataaacgtctctggt
cataggcttggaacaatggaaatagaatcagctttagttagtcatgagctgatttcagaa
gccgcagttgtgggtagacctgatgatttaaaaggagaatcaatcgtagcctttgtaacc
ttgaaaactggcgcagaagcaaatgaaaatattgaggcacaattaaaaaaacacgtcgtg
aatgaaataggccctattgctaaacctgatgagtttaagtttactgattctcttcctaaa
acaagaagtggaaaaataatgcgcagaattttgagagcactggcttcaggagatgaaata
agcggagatacaagtacccttgaggatagatcagttttagataaattaagaagttaa

DBGET integrated database retrieval system