KEGG   Prochlorococcus marinus NATL1A: NATL1_08281Help
Entry
NATL1_08281       CDS       T00467                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00330  Arginine and proline metabolism
pme00332  Carbapenem biosynthesis
pme01100  Metabolic pathways
pme01130  Biosynthesis of antibiotics
pme01230  Biosynthesis of amino acids
Module
pme_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NATL1_08281 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NATL1_08281 (proB)
Enzymes [BR:pme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NATL1_08281 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABM75386
CyanoBase: NATL1_08281
CYORF: NATL1_08281
UniProt: A2C1M6
Position
complement(761482..762564)
Genome map
AA seq 360 aa AA seqDB search
MTTWVIKIGTSLLRGNDKYTTFDVINDYCSYISKAQRNGDKIILVSSGAVGLGCHQMRFK
TRPKEIISLQASAAIGQLHLMALYEKAMSIFGYKVAQILLTRSELGSRNSYNSASQTLKR
LLEWDVIPIVNENDITSDEELKYGDNDTLSALVATAISADQLILLTDIDHLYSSDPKINS
KAKPIKDINNSKELNNLELANEQTSWGTGGIKTKLTAAKIATESGIKVQLADGRDPKILG
ELLDGKKIGTVFHPNPNPIGNRKSWLAHAIKPVGEIHLDDGASEAIKNKGASLLLVGVKK
VSGNFIANQPVKVINTEGEEIAKGICSMSSDAIKIGINSRSETTGSPLVIHRDVLVLTSE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctgggtaatcaagattggcacaagccttttgagaggaaacgataaatataca
acttttgatgtaattaatgattattgttcttatatatcaaaagctcaaaggaatggcgat
aaaattatattggtttctagtggtgctgtaggacttggatgtcatcaaatgagattcaag
acaagacctaaagaaataatctctcttcaagcttctgccgcaataggccaacttcattta
atggctttatatgaaaaggctatgagcatttttggatataaagtcgcacaaatattatta
actagatcagaattaggctcaagaaatagttataactctgcttcgcaaacattaaaaaga
ttgctcgaatgggatgttataccaatcgtaaacgaaaatgatataacctcagatgaagag
ctgaagtatggtgataatgatactttatctgcattagttgcaacagctatatctgctgat
caattaatattattaactgatatcgatcatctctactcttctgatcccaaaatcaatagt
aaagctaagccaatcaaagatattaacaattcaaaagaattaaataatttagaactagca
aatgaacaaacttcatgggggactggaggaataaaaacaaaattaactgctgcaaagatc
gccactgaaagcgggataaaagttcaattagcagatggcagagatccgaaaatattaggg
gaattacttgatggaaaaaaaataggaactgtttttcaccccaatccaaaccctatcggg
aatagaaaaagttggttggcacatgcaattaaaccagtcggagaaatacacttagatgat
ggtgctagtgaagctatcaaaaacaaaggtgcttcactattattagttggggtgaaaaaa
gttagcgggaattttattgcgaatcaacctgtgaaagttattaacacggaaggagaggaa
attgctaaaggaatttgctcaatgagcagtgatgctataaagataggaattaattcaaga
tccgaaacaacaggatctcctctagttatccaccgagatgttctggttctaacaagtgaa
taa

DBGET integrated database retrieval system