KEGG   Prochlorococcus marinus NATL1A: NATL1_08551Help
Entry
NATL1_08551       CDS       T00467                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NATL1_08551 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NATL1_08551 (rfbC)
Enzymes [BR:pme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NATL1_08551 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
784866..785447
Genome map
AA seq 193 aa AA seqDB search
MEYTTLSNEKEEIEGPLLLTPNVFNDERGYFYESWNEKIFNSILGKEVRFKQDNISHSIK
GVLRGLHYQLKPESQGKLVRCSYGSIFDVAVDIRKESKTFGKWLSAELSSENKKQLWIPV
GFAHGFLTISDHAEVNYKATGFWNKDCEHSIRWNDKDLKITWPIKEFGFEPVINEKDASA
PFLKESIMKGNIF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaatacacaacactaagcaatgaaaaagaagaaattgagggtcccttgcttcttact
ccaaatgttttcaatgatgaaagaggatatttttacgaaagttggaacgaaaaaattttt
aattcaatcttagggaaagaggtcagatttaaacaagataatatttctcattcaataaaa
ggagtattgagagggcttcattatcaattaaaacctgagtcacaagggaagttagttcga
tgtagttatggctcaatttttgatgttgcagttgacattaggaaagaatctaaaaccttc
ggtaaatggcttagtgcagagcttagttccgaaaataaaaaacaattatggataccagtt
ggatttgcacatggatttctaactattagtgatcatgctgaagttaattacaaagcaacg
ggattctggaataaagactgcgaacactctattcgctggaatgacaaagacttgaaaata
acttggcctataaaggagtttggctttgaaccagtcattaacgaaaaagatgcatctgct
cctttcttgaaagagtcaataatgaaagggaacatattttaa

DBGET integrated database retrieval system