KEGG   Prochlorococcus marinus NATL1A: NATL1_09141Help
Entry
NATL1_09141       CDS       T00467                                 

Gene name
amyA
Definition
glycoside hydrolase family protein (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NATL1_09141 (amyA)
Enzymes [BR:pme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     NATL1_09141 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
845213..846964
Genome map
AA seq 583 aa AA seqDB search
MSELDSELDELRLSLREIYPEHSEQEINSVWSQLLQILDPFCVSKGTDEFEIESIWDSSS
VVLITYPDSIYRKDESTLKTLTEFVKNRLGGLSSVIHVLPFLPSTSDGGFAVSNHEKIDD
TFGNWNDLKDLSSKHKIMADLVLNHVSSSHPWVHQFIKSEDPGPSYIVSPSETNVWENVI
RPRNTSLFTNINTKQGFKSVWTTFGPDQIDVDWRNPHIFLEFLKLLVRYITNGADWIRLD
AIAFIWKEPHTTCLHLDPVHSIVKLLNKCLKIIKPSAVLITETNVPEKENLSYLIEGNEA
NLAYNFTLPPLLLEAIYTGKTDLLKSWLSTWKELPRHTSLLNFTSSHDGIGLRALEGIMD
DQRIHNLLVESEKRGGLVSHRRLSNGDDQPYELNISWWSAMSNEGSDKTVFQFERFLLSQ
LFTLSIKGVPAFYLPSVLASPNDIDSFRKTGQRRDLNREKFEANQLLDVLKNFDSPASKN
ISYLTHIVKVRSRLKAFHPEASMKCISTNIANCIILQRGLDEDTVYVICNMSSKFLSISP
LNQINSLELTSEKRLLDNISGSYFNTDTFKLNPYQVVWLTLAD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagttggatagtgaattagacgagctgagattgtctctcagagaaatttatcct
gagcactctgaacaagaaatcaattcagtgtggtcgcaattgttgcagattcttgatcca
ttttgtgttagcaagggcactgatgaatttgagatcgaatcaatttgggattcttcaagt
gttgttttgattacttaccctgattcaatttataggaaagatgaatcaactttaaaaaca
ttaactgaattcgtaaaaaatagattaggtggcctttcatcagtcatacatgttttacca
tttcttccttctacaagtgatggaggattcgctgtatctaatcatgaaaaaatcgatgat
acctttgggaattggaatgatttaaaagatttatctagtaagcataaaataatggcagat
ctagttttaaatcatgtctcttcttctcatccatgggttcatcaatttataaaatcagag
gatccaggtccgtcttacattgtttctccttctgagactaatgtttgggaaaatgtgata
aggcccagaaatacatcactctttaccaatatcaatactaaacaaggctttaagagtgtt
tggacaacctttggaccagatcagattgatgttgattggaggaatccacatatcttttta
gagtttttgaaattattggttagatacataactaatggagctgactggattcgacttgat
gcaattgcatttatttggaaggagccacatactacttgtttacatttagacccagtacac
tcaatagttaagctgttaaataaatgtttgaagattataaaaccttcggcagtattaatt
accgagactaatgtgccagagaaagaaaacctttcttatttgattgaaggaaatgaagct
aatcttgcatataactttactctacctcctttattattagaagctatttataccggtaaa
acagatttattgaagagttggttgtctacgtggaaagagttgccaaggcacacttctttg
ctcaacttcacttcttcacacgatggtattggattacgagcactagaaggcattatggac
gatcagagaatacataatctcttggttgaatcagagaaacgaggaggattagttagtcat
cgtcgcttgtcaaatggagatgatcaaccttatgaattaaacattagttggtggagtgcg
atgtcaaacgaaggctccgataaaacggtatttcaatttgagcgttttttattaagtcag
ctttttactttatccataaaaggtgttccagctttttatcttccatctgtattagcttct
ccgaatgatatagattcttttaggaaaacagggcaaagaagagatttaaatcgagaaaaa
tttgaagctaaccaattacttgatgtacttaagaactttgattctcccgctagtaaaaat
atttcatacctcactcatatagttaaagtcaggtcaagacttaaagcttttcatccggag
gcgagtatgaaatgtatctctacgaatatagctaattgtataattcttcaaagaggtttg
gatgaagatactgtctatgttatttgtaatatgtctagtaaattcttatctatttctcca
ttaaatcaaattaattcattagaattaacctctgaaaaacgtttactagataatatttca
ggttcttattttaatactgatacttttaaacttaatccttatcaagtcgtttggcttaca
ttagctgattag

DBGET integrated database retrieval system