KEGG   Prochlorococcus marinus NATL1A: NATL1_09481Help
Entry
NATL1_09481       CDS       T00467                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pme00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
874226..875185
Genome map
AA seq 319 aa AA seqDB search
MEPSKANEDFLIAKAHAKINLHLEVLGIRSDGFHELAMVMQSINLSDQLKMIKRVDNTIN
LKSNNKEISNGDDNLIIKASKLLRNKVENQELGVDIELEKNIPIGAGLAGGSTDAAATLL
GLNKLWKLNLKTDELENLSKEIGSDIPFCISGGRQICFGRGEILEKLKFDQIQLGLILVK
DPSIQVSTPVAYKKYKDQFGESYLEDDRDFEIKRNSIRSIDWSDQSLFDNRKEIQNDLQK
SVRPITPEVEKSLDLLSSLPDSRLVSMSGSGPSCFALFQNYDQANKVLKEHVNEFERAGL
SAWACSMMSNGVELRNEFI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttccaaagcaaatgaagattttcttatcgcaaaagcacatgcaaaaattaat
ctacatttagaggttttaggtattaggagcgatggctttcatgaattagcaatggtcatg
caaagtattaatttaagtgatcagttgaagatgataaaaagagtagataatactattaat
ctaaaatctaataataaagaaattagtaatggtgacgataatctaataataaaagcttca
aagctgttgagaaataaagtagaaaatcaagaattaggtgttgatattgaacttgagaaa
aacattcctattggagcaggattggcagggggatctacagatgcagctgcaaccttactt
ggattaaataaactctggaagctaaatcttaagactgatgaattagagaacctatcaaaa
gaaataggatcagatatccctttttgcatatcaggagggaggcaaatatgttttggtaga
ggtgaaattttagaaaaattgaaatttgatcaaattcagttaggtcttattttggttaaa
gacccttcaatacaagtatctactccagttgcatacaaaaaatataaagatcagtttggt
gaaagctatcttgaagatgatagggattttgaaatcaaaagaaactctattagatctatt
gactggtctgatcagtcgctttttgataatcgtaaagaaatacaaaatgatttacaaaaa
agcgttcggcctataacaccagaggttgagaagtcattggatttattgtctagtttgcca
gattcacgtcttgtttcaatgagtggttctggtccaagttgttttgccttgtttcaaaat
tatgaccaagcaaataaagtactcaaagaacatgttaatgaatttgaaagggctggttta
tcagcttgggcatgttcaatgatgtctaatggagttgaattaagaaatgaattcatctag

DBGET integrated database retrieval system