KEGG   Prochlorococcus marinus NATL1A: NATL1_10621Help
Entry
NATL1_10621       CDS       T00467                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pme00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
978561..982574
Genome map
AA seq 1337 aa AA seqDB search
MFTQVRSANRRVSPVENHKHKAVMKAVYVVLEPQYQNALTQAANSLNSQNGPIGIELNGY
LIEELRDTNNYESFKKDIENADLFVASLIFIEDLAQKVVEAVEPHKDSLKAAVVFPSMPE
VMRLNKLGTFSMAQLGQSKSIIGDFMKKRKEAGGAGFQDSMLKLLNTLPSILKYLPVDKA
QDARSFMLSFQYWLGGTPDNLRNFLLMLGDKYVFPELNKEEEKIEVAEPEVFPDLGIWHP
LAPNMFEDKKEYLNWTASRDDLSSKAKNGPVIGLVLQRSHIVTGDDAHYVAVIQELEYRG
ATVIPVFCGGLDFSKPVNEYYYDPINLDKPIVDGVVSLTGFALVGGPARQDHPKAVEALK
KLNRPYMVALPLVFQTTQEWEGSDLGLHPVQVALQIAIPELDGAIEPIVLSGRDDATGKA
HTLQDRVDAIAERAIRWSSLRIKKRDQKKLAITVFSFPPDKGNVGTAAYLDVFGSIYRVL
EEMKLKGYDIKDLPKNPKELMETLINDPEALQGAPELSIAHRMSVKEYEKLTPYSERLEE
NWGKPPGNLNSDGQNLLIYGKEFGNVFVGVQPTFGYEGDPMRLLYSRSASPHHGFAAYYT
YLEKVWKADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGGLPNLYYYAANNPSEATIA
KRRGYASTISYLTPPAENAGLYKGLKELGELVGSYQQLRESGRGIQIVNAIVETSKKCNL
DEDVKLPEKDASELEIDERDLVVGNVYKQLMEIESRLLPCGLHTIGKPATAEEAIATLVS
IASIEREDDGIRSLPGLLAESKGKTIEEVYEGNNKGRLEDVELNKLITETSREAVGSMVR
SLTGRDGRVNMKKNIWTLIVEFLRGIGFSIPSPWQASAKKAGFENVNQGSLDKVFDYLRF
CLEQICADKEMESLLKALDGDYVIPGPGGDPIRNPGVLPSGKNIHALDPQSIPTVAAVAS
AKGVVDKLIERQKEEQGTWPETIACVLWGTDNIKTYGESLAQILWFVGVKPKPDSVGRVN
KLELLSLEELGRPRIDVVVNCSGVFRDLFINQMALIDQAVKMAAEADEPLDQNFVRKHVL
EQAEKEGKSIRESASRVFSNASGSYSSNVNLAVENSTWEEENELQEMYLSRKTFAFNADN
PGEMNQNRDVFESVMKTADVTFQNLDSSEISLTDVSHYFDSDPTNLIKNLRDDGKAPSSY
IADTTTANAQVRSLSETIRLDSRTKLLNPKWYEGMLKSGYEGVREVSNRLNYTLGWSATS
GQVDNFVYEESNETFINDPEMRKRLMELNPHSFRRIVGTLLEVNGRGYWETSDENIEQLK
ELYQEVEDRIEGVNTED
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacaggttcgctcagcaaatcgcagagtttcacctgtcgagaatcacaagcat
aaagctgtgatgaaggctgtttatgtagtccttgagcctcaatatcaaaatgctcttaca
caggctgctaactcattaaattcgcaaaatggccctattggaattgaacttaatggatat
ttaattgaagaacttagagatacaaacaattatgaaagctttaaaaaagatatagaaaat
gctgatttattcgtagcttcattgattttcattgaagatttggcgcaaaaagttgttgaa
gcagttgaacctcacaaagacagtcttaaggcagcggtggtatttccatctatgccagaa
gtaatgcgattgaataaattgggaactttttctatggcgcagttaggccaaagtaaaagc
atcattggcgattttatgaagaagaggaaagaagcaggcggagctggatttcaagattca
atgttgaagcttctaaataccctaccctcaattcttaagtatctgccagtagacaaagca
caagacgctcgtagttttatgcttagttttcaatattggttaggaggaactccagataat
cttcgaaatttcttactaatgcttggagataaatatgtatttccagaactaaataaagaa
gaagaaaaaattgaagttgcagagcctgaagttttccctgatttaggaatatggcatcct
ttagctccaaatatgtttgaggataaaaaagaatacttaaattggacagcttctagggat
gatttatcaagtaaggctaaaaacggtcccgtaatcggactagtacttcaaagaagtcac
attgttactggagacgatgctcactacgtcgcagttattcaagaattggaatatcgggga
gcaaccgtaattcctgttttttgtggtggattagatttttccaagccagtaaatgaatat
tattacgatccaataaatcttgataaacccattgtagatggcgttgtttcacttacaggt
ttcgcacttgtgggaggtcctgcaaggcaagatcacccaaaagcggtcgaggctttaaaa
aagctcaatcgaccttacatggttgctttgccactcgtttttcaaacaactcaagaatgg
gaaggaagtgacttaggacttcatccagttcaagttgcacttcaaattgcaattcctgaa
ttagatggtgctattgagccaatagttttatctggtcgagatgatgcaactggcaaagct
catacactacaagacagagtagatgcaatagctgaaagagctatcagatggtcatcacta
agaattaaaaaacgtgaccagaagaaattagctattactgtatttagttttccacctgat
aaaggaaatgttggaacagctgcttacttagacgtctttggctctatttatagagtttta
gaagaaatgaagctaaaaggttatgacataaaagatctacctaagaatccaaaagaacta
atggagacattaataaatgatccagaagctttacaaggtgctcctgagctatcaatagcg
catcgaatgagtgtaaaagaatatgagaaattaactccatattctgagagactagaagag
aactggggaaagccaccgggaaatttaaatagtgacggacaaaatcttcttatatatgga
aaagaatttggaaatgtatttgtaggggtgcaaccaacttttggatatgaaggtgatcct
atgagattgctttattctagaagtgccagtcctcatcatggatttgccgcttattacact
tatttagaaaaagtttggaaggcagacgcagttctacattttggaacccacggatcgctt
gaattcatgcccgggaaacaaatgggtatgagcgagacatgttatccagattcattgatt
ggaggtctacctaatctttactactacgcagcaaataatccttcggaagcaacaatcgca
aaaagaagaggatacgcatcaacaattagttatttaacgccccctgctgaaaatgctgga
ctatataaaggtctaaaagaacttggagagttagttggttcctatcaacaattaagagaa
agtggaagaggaattcaaattgttaacgcaatagttgaaacatcaaaaaaatgtaatctt
gatgaagatgtcaaactacccgaaaaagatgcctccgaattagaaatagatgaaagagat
ttggtagtaggaaatgtatataaacaattaatggaaatagaaagtcgattattaccttgc
ggcttacacaccattggtaaaccagctactgctgaggaagcaattgcaaccttggtaagt
atcgcatctatagaaagagaagatgatggaatcagatctttgccaggtttattagcagaa
tcaaaaggaaaaacaattgaggaagtctatgaaggtaataacaagggaagattagaagat
gttgaacttaataaattaattacagaaacatcaagagaagctgttggttcaatggttaga
tctcttacaggaagagatgggagagtaaatatgaagaagaatatctggacgctaattgtt
gagttcttgagaggaattggtttctcaattccatcaccatggcaagcatctgctaagaaa
gcaggttttgaaaatgtaaatcaaggttctctagataaggtctttgactatttgagattt
tgcttagagcaaatatgtgcagataaagagatggagagccttttaaaagctctagatgga
gattatgtgattcctggtcctggaggagatccaattaggaacccaggagtattaccaagt
ggtaaaaatattcatgcattagacccccaatcgataccaactgttgcggctgtggcttca
gccaaaggagtagttgacaaacttattgagaggcagaaagaggagcaaggtacatggcca
gagactatcgcttgcgtactttggggtactgacaacatcaaaacttatggtgaatcatta
gctcaaatcctttggtttgtaggagtaaaaccaaaaccagattctgtcggaagggtaaat
aaattagaactcctttctcttgaggaactaggaagaccaagaattgatgtagtagttaac
tgctctggagtgtttagagatttgtttattaatcaaatggcattaattgaccaagcagta
aaaatggctgctgaggctgatgaaccacttgatcaaaacttcgtaagaaagcatgtctta
gagcaggctgaaaaggaaggtaaaagtattagggaatcagcaagtagagtgttctcaaat
gcaagtggaagttatagctcaaatgtcaatttggctgtagagaattcaacatgggaagaa
gaaaatgaattgcaagaaatgtacctttcaagaaaaacatttgcttttaacgcagataat
ccaggggaaatgaatcagaacagagacgtttttgaatcagtcatgaaaactgctgatgtt
accttccaaaatcttgattcttctgaaatatcgttaacagatgtaagtcattactttgac
tcagatccaacaaatttaattaagaatcttagagatgatggtaaagcgccaagtagttac
atagccgacacaactacagcaaatgctcaggtcagatcattaagtgaaactattcgatta
gattccagaacaaaattacttaacccaaaatggtatgaaggaatgcttaaatcaggatat
gagggagtaagagaggtttctaatagacttaattacacattaggatggagtgcaactagt
gggcaagttgacaatttcgtatatgaagaatcaaacgaaacttttataaatgatccagag
atgaggaaaagattaatggaattaaatcctcatagttttagaagaatagttggtacatta
ttagaagttaacgggagaggatattgggaaacatctgatgaaaatattgaacaattaaaa
gaactttatcaagaagtagaagatagaatcgaaggggttaatacagaagattaa

DBGET integrated database retrieval system