KEGG   Prochlorococcus marinus NATL1A: NATL1_14831Help
Entry
NATL1_14831       CDS       T00467                                 

Gene name
recR
Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NATL1_14831 (recR)
DNA repair and recombination proteins [BR:pme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NATL1_14831 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1194366..1194914
Genome map
AA seq 182 aa AA seqDB search
MPGIGPRTAQRLALHLLRQPEDKIRLFSEALLNAKSQVGQCKTCFHLTAGEQCEICLNKQ
RNQELICVVSESRDLLALERTREYKGLYHVIGGLISPMDGIGPEMLEISSLIKRVDKANI
KEVILALTPSIEGDTTSLYVGRLLKPFTKVTRIAYGLPVGSELEYADEVTLSRALEGRRD
LD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggtatcggtccaagaactgctcaaagattagctcttcatcttttgcgtcagcca
gaagacaaaattagattgttttcagaagctctacttaatgcgaaaagtcaggtaggtcaa
tgtaagacgtgctttcatttaaccgcaggagaacaatgtgaaatttgtttaaacaagcaa
agaaatcaagaactcatttgcgttgtttctgagtcaagagatttacttgctcttgagcgc
actagagagtacaaagggctttatcatgtaattggtgggttaatttctccgatggatggg
attggacctgaaatgcttgagatatcaagtcttatcaaaagagtcgataaagccaatata
aaagaagtcatccttgccctaacaccaagtattgaaggggatacgactagtctttatgtg
ggtagattattaaaaccattcacaaaagtcactcgtattgcttatggacttcctgttgga
agtgagttggaatatgccgatgaagtaacactctcacgtgctttagaaggtcgtagagac
ttagattaa

DBGET integrated database retrieval system