KEGG   Prochlorococcus marinus NATL1A: NATL1_15011Help
Entry
NATL1_15011       CDS       T00467                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pme00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1212765..1214261)
Genome map
AA seq 498 aa AA seqDB search
MKLERNSGILLHPTSLPDSPVCGSFGKPAREWLNELAAFGIGVWQFLPLAPTDLFGSPYS
SPSSFALNPWFLDQNDLVRDGFLANNLEDFSSANDCFNNRVDFHLANSKVKFLRFSLVDD
WYKQNRTIQEEFEIWCSKQFWLDDHSIFMELKIQNNDLPWWEWPVEYAGRDKKELENWKK
NNQKELLGHKLLQWHLDRQWQSIRALAKNLGIYLFGDVPFYVSKDSADVWGNRSLFSILT
NSDTFLQSGVPPDYFSETGQLWGNPVYRWSRHKSSRYRWWRKRISRHLEQVDFLRLDHFR
ALEAFWAIPGKDKTAENGFWLPSPGKQILSLIKKDCCGSLPLIAEDLGLVTSKVEKLRDD
YELAGMKILQFAFDGNLDNPYLPENIKEENWIVYTGTHDNSTSLGWWREMDQGRKEQLRE
RIFDYENFTSWELIRIGMETKAKLFVAPMQDLLNLDDSCRLNKPGTTENNWSWRLTRNDL
NIRDALKKYGDLAKANKR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggaaagaaattcaggaatcctgcttcatccaacctcattacctgatagtcct
gtttgcggtagttttggtaaacctgctcgagaatggcttaatgaacttgctgcctttgga
ataggtgtgtggcaatttttacctcttgctcctactgatttatttggatctccatatagc
tctccatcaagttttgctttgaacccatggttccttgaccaaaatgatttagtgagggac
ggattcttagctaataacctggaagatttttcttctgcaaatgattgttttaataataga
gttgattttcatttagcaaattcaaaagttaagttcttacgtttttctttggttgatgat
tggtataaacagaacagaactattcaagaagaatttgaaatatggtgctcaaaacaattt
tggttagatgatcattccatatttatggaactcaagattcaaaacaatgaccttccatgg
tgggaatggccagttgaatatgcaggtagggataagaaagaattagaaaattggaaaaaa
aataaccaaaaagaattattaggccataaacttctccagtggcatttagacaggcagtgg
caatcaatcagagcgcttgcgaaaaatctaggaatttatttatttggagatgtccctttt
tatgtatcaaaagatagtgctgatgtatggggtaatcggtcattattttctattttgact
aattcagatacattccttcaaagtggagtcccacctgattatttttctgaaaccggtcag
ctctggggtaacccagtttatcgctggagtaggcacaaatcaagtagatatagatggtgg
agaaaaagaatttcaagacatctagaacaggtagattttttacgccttgatcattttcgt
gccctcgaagctttttgggcaattcccggcaaagataaaacagcagagaatggattttgg
ttgccctctccaggaaaacagatactaagtttaatcaaaaaagattgctgcggctctctt
ccattaattgctgaagacttaggtctcgtaacctcaaaagtagagaagttacgcgatgat
tatgaattagcaggaatgaagatacttcaattcgcttttgatgggaatttagataatccg
tatttgccagagaatattaaagaagaaaattggattgtttatacaggaacgcacgacaat
tcaacttctcttggctggtggagagaaatggatcaaggtagaaaagaacaacttagagaa
aggatttttgattatgagaatttcacttcttgggaattgattcgaataggcatggaaact
aaagccaaattatttgtagcacctatgcaagatttgttaaatcttgatgatagctgtcgt
ttaaacaaacctggcacaacagaaaataattggtcatggagattaacgagaaatgattta
aatattagagatgctttgaaaaaatatggtgatttagctaaagcaaataaaagataa

DBGET integrated database retrieval system